Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_013643859.1 METBO_RS01305 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_000191585.1:WP_013643859.1 Length = 393 Score = 318 bits (815), Expect = 2e-91 Identities = 175/386 (45%), Positives = 245/386 (63%), Gaps = 7/386 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGE-EVEEAREKALRTGASKAIALD 60 K+VLA+SGGLDTS+ +K L+E Y EV+ D+GQ E E+E + A G K +D Sbjct: 3 KVVLAFSGGLDTSVCVKLLQEKYNMEVVTACVDVGQPEDEIERPAQVANNIGVKKHYTID 62 Query: 61 LKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGN 120 K EF +F+F ++A A+YEGY L TS+ARPLIA +V +A++E A+AIAHG TGKGN Sbjct: 63 AKHEFAEEFIFRAIKANAMYEGYPL-STSLARPLIAMKIVELAKKEQADAIAHGCTGKGN 121 Query: 121 DQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLH 180 DQ RFE T + +IAP R+ + +EM YA + IPVP +K YS+D NL Sbjct: 122 DQFRFETTIRSSSV-CDIIAPVRDLNLTRTEEM-DYAVKNDIPVP--SDKLYSIDENLWG 177 Query: 181 ISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQ 240 S EG +LEDP E P+ F TQ E APD P+ + V F EG PVA++GE ++ ++Q Sbjct: 178 RSIEGDILEDPMVETPEEAFEWTQSTENAPDEPQKLTVTFEEGVPVAIDGEMMNALEIIQ 237 Query: 241 RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDM 300 N I G HG+GRVDI+E+R +G+KSR YETPG +L A +A+E LTL RE L + Sbjct: 238 EANRIAGLHGIGRVDIIEDRIIGLKSRENYETPGAELLITAHKALEQLTLTREELKFGET 297 Query: 301 LSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQ 360 ++ Y+ELVY G W+ P RE L D++ V+G LKL+KG++ ++ R++P SLY + Sbjct: 298 VTQAYSELVYNGLWHEPLREDLDCIIDNMQLRVSGDVILKLHKGSIRILARESPYSLYSE 357 Query: 361 DLVSFDEAGGYDQKDAEGFIKIQALR 386 + VSF++ DQ++ G +K L+ Sbjct: 358 EAVSFEDK-EMDQREIAGMVKNYGLQ 382 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 393 Length adjustment: 31 Effective length of query: 369 Effective length of database: 362 Effective search space: 133578 Effective search space used: 133578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013643859.1 METBO_RS01305 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.6878.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-171 554.5 0.2 9.3e-171 554.3 0.2 1.0 1 lcl|NCBI__GCF_000191585.1:WP_013643859.1 METBO_RS01305 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000191585.1:WP_013643859.1 METBO_RS01305 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 554.3 0.2 9.3e-171 9.3e-171 1 394 [] 3 391 .. 3 391 .. 0.98 Alignments for each domain: == domain 1 score: 554.3 bits; conditional E-value: 9.3e-171 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdy 68 kvvla+sGGlDtsv++kll+ek ++ev++++vdvGqpe+++++ ++ a ++G++k+y+iDa++ef++++ lcl|NCBI__GCF_000191585.1:WP_013643859.1 3 KVVLAFSGGLDTSVCVKLLQEKyNMEVVTACVDVGQPEDEIERPAQVANNIGVKKHYTIDAKHEFAEEF 71 8******************************************************************** PP TIGR00032 69 lfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkv 137 +f+ai+ana+yeg Y+lst+LaRplia k+ve akke a+a+ahGctgKGnDq+RFe++i+ + + ++ lcl|NCBI__GCF_000191585.1:WP_013643859.1 72 IFRAIKANAMYEG-YPLSTSLARPLIAMKIVELAKKEQADAIAHGCTGKGNDQFRFETTIR-SSSVCDI 138 *************.***********************************************.77889** PP TIGR00032 138 iaPvreleliReeeieyaaekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdpie 206 iaPvr+l+l+R+ee++ya ++ i+vp++ k ysiDenl+grsiE+++LEdp++e pe+++e+++ +e lcl|NCBI__GCF_000191585.1:WP_013643859.1 139 IAPVRDLNLTRTEEMDYAVKNDIPVPSD--KLYSIDENLWGRSIEGDILEDPMVETPEEAFEWTQ-STE 204 *************************998..8**********************************.566 PP TIGR00032 207 ktedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapall 275 + +dep++++++Fe+GvPva++ge+++++e+i++an+iag hG+Gr+Di+EdRiiglKsRe+YE+p++ lcl|NCBI__GCF_000191585.1:WP_013643859.1 205 NAPDEPQKLTVTFEEGVPVAIDGEMMNALEIIQEANRIAGLHGIGRVDIIEDRIIGLKSRENYETPGAE 273 666****************************************************************** PP TIGR00032 276 lLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvklfkGn 344 lLi+Ahk+Le+l+lt+++l+f e+v++ ysel+Y+Glw++pl+e+ld +i+++q rv+G v +kl+kG+ lcl|NCBI__GCF_000191585.1:WP_013643859.1 274 LLITAHKALEQLTLTREELKFGETVTQAYSELVYNGLWHEPLREDLDCIIDNMQLRVSGDVILKLHKGS 342 ********************************************************************* PP TIGR00032 345 aivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqikvyreklk 394 ++++r+s+yslY+ee vsfe dke+dq++ +G++k++glq++ y++++k lcl|NCBI__GCF_000191585.1:WP_013643859.1 343 IRILARESPYSLYSEEAVSFE-DKEMDQREIAGMVKNYGLQAACYQKVCK 391 *********************.***********************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory