GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisI in Methanobacterium lacus AL-21

Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_013644223.1 METBO_RS03165 phosphoribosyl-AMP cyclohydrolase

Query= metacyc::HISTCYCLOPRATPPHOS
         (203 letters)



>NCBI__GCF_000191585.1:WP_013644223.1
          Length = 132

 Score = 87.8 bits (216), Expect = 8e-23
 Identities = 52/131 (39%), Positives = 73/131 (55%), Gaps = 7/131 (5%)

Query: 7   RRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGE 66
           R E+  EK   L+  I Q  VS EVLM+ YMN EAL KTLE+G   ++S ++++LW KGE
Sbjct: 9   RHEVGGEK---LVIAIAQDHVSSEVLMVAYMNEEALKKTLETGIAHYYSTSRKKLWLKGE 65

Query: 67  TSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERK 126
           +SG+   V  +  DCD D +L+     G  CH+G  SCF     + +     E  L ++K
Sbjct: 66  SSGHTQEVKEVLTDCDEDAVLLKVEQNGGACHEGYYSCF----FRKIETDSGELKLVKQK 121

Query: 127 SADPETSYTAK 137
             +PE  Y  K
Sbjct: 122 IFEPEQIYGEK 132


Lambda     K      H
   0.317    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 73
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 203
Length of database: 132
Length adjustment: 18
Effective length of query: 185
Effective length of database: 114
Effective search space:    21090
Effective search space used:    21090
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory