Align Probable 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_013645640.1 METBO_RS10230 3-isopropylmalate dehydratase large subunit
Query= curated2:O27439 (419 letters) >NCBI__GCF_000191585.1:WP_013645640.1 Length = 414 Score = 498 bits (1282), Expect = e-145 Identities = 233/413 (56%), Positives = 311/413 (75%), Gaps = 1/413 (0%) Query: 3 MTVSEKILARASGKDRVEAGEIVMADIDVAMTHDLTGPLSVESFRAIGEDRVWDPEKIVV 62 M ++EKILARA+GK+ V GEI+ D+D+AM HD T P ++ +F+ I +D+VWDPEKIV+ Sbjct: 1 MNITEKILARAAGKEEVHPGEIIEVDVDLAMAHDGTSPPTINNFKKI-QDKVWDPEKIVI 59 Query: 63 IFDHQVPADSIEAAQNHMIMRDFVEEQGIRNFYDVREGVCHQVLPEKGHVVPGEVVVGTD 122 I DH VP ++I +A+ H + R+F +QGI+N+ + EG+CHQVLPE G V PGEVVVG D Sbjct: 60 ICDHTVPPNTIGSAEFHKVSREFARDQGIKNYLNHGEGICHQVLPEYGFVKPGEVVVGAD 119 Query: 123 SHTCTHGALGAFATGIGSTDMAMVFATGKLWFRVPETLRFDVRGKLREHVYAKDVILNII 182 SHTCTHGA GAFATG+G+TDMA +FATG+ WFRVPE + V GKL V AKDVILN+I Sbjct: 120 SHTCTHGAFGAFATGVGATDMAFIFATGQTWFRVPEAYKITVDGKLGNFVSAKDVILNVI 179 Query: 183 GRVGADGATYMACEFAGETVAEMSVSDRMVLSNMAIEMGGKTGIVEPDEKTLNYVRRRSG 242 G +G GATY + EF G T+ M V+ RM + NMAIE G K GI+EP++ TL Y++ R+ Sbjct: 180 GEIGTYGATYKSLEFCGNTIENMDVAGRMTICNMAIESGAKNGIMEPNKATLQYLKDRNV 239 Query: 243 KPWRVFKTDPDAPSLSVMEVDVSDLEPQVACPHNVDNVKPVTEVEGTEIDQVFLGSCTNG 302 K + V +DPD DV D+EPQVACPHNVDNVKP+++V G I+Q F+GSCTNG Sbjct: 240 KGFDVVTSDPDYTYEKEYFFDVDDMEPQVACPHNVDNVKPLSKVTGKTINQAFIGSCTNG 299 Query: 303 RLSDLRDAAAILKNRKVSDSVRMLVIPASREVYRRALDEGLIEIFVDAGALVCNPCCGPC 362 R+ DL AA +L+ ++V VR+L+IPAS E+YR+A++ GL++IF+D+GA++CNP CGPC Sbjct: 300 RMEDLVAAAEVLEGKRVHPDVRLLIIPASAEIYRKAINSGLVDIFMDSGAIICNPGCGPC 359 Query: 363 LGGHVGLVGPGEVSLSTSNRNFRGRQGSPEAEVYLSSAAVAAASAVKGSITHP 415 LGGH+G++ GEV ++T+NRNF GR G PE+EVYL++ AV A+SA+ G I P Sbjct: 360 LGGHMGVLAAGEVCVATTNRNFLGRMGDPESEVYLANPAVVASSALSGEINDP 412 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 414 Length adjustment: 31 Effective length of query: 388 Effective length of database: 383 Effective search space: 148604 Effective search space used: 148604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013645640.1 METBO_RS10230 (3-isopropylmalate dehydratase large subunit)
to HMM TIGR02086 (3-isopropylmalate dehydratase, large subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02086.hmm # target sequence database: /tmp/gapView.25949.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02086 [M=411] Accession: TIGR02086 Description: IPMI_arch: 3-isopropylmalate dehydratase, large subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-192 624.1 1.0 5.5e-192 623.9 1.0 1.0 1 lcl|NCBI__GCF_000191585.1:WP_013645640.1 METBO_RS10230 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000191585.1:WP_013645640.1 METBO_RS10230 3-isopropylmalate dehydratase large subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 623.9 1.0 5.5e-192 5.5e-192 1 411 [] 1 414 [] 1 414 [] 0.99 Alignments for each domain: == domain 1 score: 623.9 bits; conditional E-value: 5.5e-192 TIGR02086 1 ktlaekilsekvGke.vkaGeivevkvDlvmvhDgtgplvikalrelgakvekkekivlvfDhvvPapt 68 ++++ekil++++Gke v++Gei+ev vDl+m+hDgt+p +i++++++++kv+++ekiv++ Dh+vP++t lcl|NCBI__GCF_000191585.1:WP_013645640.1 1 MNITEKILARAAGKEeVHPGEIIEVDVDLAMAHDGTSPPTINNFKKIQDKVWDPEKIVIICDHTVPPNT 69 689**********988***************************************************** PP TIGR02086 69 veaaelqkeirefakelgikv.fdvgeGichqvlvekgyakpgkvvvgaDshtttsGalgafatGlGat 136 + +ae++k+ refa+ +gik+ + geGichqvl e g++kpg+vvvgaDsht+t+Ga+gafatG+Gat lcl|NCBI__GCF_000191585.1:WP_013645640.1 70 IGSAEFHKVSREFARDQGIKNyLNHGEGICHQVLPEYGFVKPGEVVVGADSHTCTHGAFGAFATGVGAT 138 *********************9999******************************************** PP TIGR02086 137 DvalalatGktWlkvPesikveleGkleekvtakDvileivkelgadgatykaieftgeeiealsldeR 205 D+a+++atG+tW++vPe+ k++++Gkl + v+akDvil++++e+g+ gatyk++ef g++ie++++ +R lcl|NCBI__GCF_000191585.1:WP_013645640.1 139 DMAFIFATGQTWFRVPEAYKITVDGKLGNFVSAKDVILNVIGEIGTYGATYKSLEFCGNTIENMDVAGR 207 ********************************************************************* PP TIGR02086 206 ltlsnlaveagakaglvepdeetleylkkrrge.frilkadedakyeeeieidlseleplvavPhsvdn 273 +t++n+a+e gak+g++ep++ tl+ylk r+ + f ++++d+d +ye+e+ +d++++ep+va+Ph+vdn lcl|NCBI__GCF_000191585.1:WP_013645640.1 208 MTICNMAIESGAKNGIMEPNKATLQYLKDRNVKgFDVVTSDPDYTYEKEYFFDVDDMEPQVACPHNVDN 276 ****************************999888*********************************** PP TIGR02086 274 vkeveevegteidqvfiGsCtnGRledlkiaaeilegrevhkdvrlivvPasrkvyekaleeGlietlv 342 vk++++v g++i+q+fiGsCtnGR+edl +aae+leg++vh+dvrl+++Pas ++y+ka+++Gl+++++ lcl|NCBI__GCF_000191585.1:WP_013645640.1 277 VKPLSKVTGKTINQAFIGSCTNGRMEDLVAAAEVLEGKRVHPDVRLLIIPASAEIYRKAINSGLVDIFM 345 ********************************************************************* PP TIGR02086 343 eaGaiiltpgCGPClGahlGvladgevivsttnRnfkGRmGspkaeiYLasPavaavsaveGeitdpee 411 + Gaii++pgCGPClG h+Gvla gev+v+ttnRnf GRmG+p++e+YLa+Pav+a sa++Gei dp++ lcl|NCBI__GCF_000191585.1:WP_013645640.1 346 DSGAIICNPGCGPCLGGHMGVLAAGEVCVATTNRNFLGRMGDPESEVYLANPAVVASSALSGEINDPRD 414 *******************************************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (411 nodes) Target sequences: 1 (414 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.20 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory