Align Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 (characterized)
to candidate WP_013646048.1 METBO_RS12305 type I glutamate--ammonia ligase
Query= SwissProt::Q60182 (454 letters) >NCBI__GCF_000191585.1:WP_013646048.1 Length = 442 Score = 486 bits (1252), Expect = e-142 Identities = 240/449 (53%), Positives = 316/449 (70%), Gaps = 8/449 (1%) Query: 5 MEMNVEQAIEYVKKNNVKFIRFQFVDILGFPKNVAYPVKAGEKGIEELREIFENGVWFDG 64 ME + + IE +++ KFIR QFVDI G PKN+A P+ E ++ +I ++G+ FDG Sbjct: 1 MEDKIGKVIENIERCGTKFIRLQFVDIHGTPKNMAVPISKPE----DIEDILKDGLLFDG 56 Query: 65 SSITGFVGIEESDMLLKPDLSTLSVLPWRPEEKSVARVICDVYKDEKTPFEGDPRSRLKA 124 SS+ GFV I SD+++KPD T S LPWRPEEK V R ICD+Y + TPFEGDPR LK Sbjct: 57 SSVDGFVDINASDLIIKPDPDTFSTLPWRPEEKGVCRFICDIYWPDMTPFEGDPRYILKK 116 Query: 125 ILEELKKEMNGEYFVGPEPEFFLLKRDPHNPHRWVPADDGGYFDVEPLDDAPDIRRDIVL 184 L +++ + EY VGPEPEFF++ D VP D+G YFDVEP+D D+RR++VL Sbjct: 117 ALAKIE-DKGYEYNVGPEPEFFIIGEDAEG--HIVPHDNGIYFDVEPVDQGTDVRRELVL 173 Query: 185 ALENLGFHVEASHHEVAPGQHEVDFKFDNALKTADSVITFKMTIKNIAKKHGLKATFMPK 244 LE L F VE SHHEV PGQHE+DFKFD+A+KTAD+VITFK IK I G TFMPK Sbjct: 174 GLEELNFEVEVSHHEVGPGQHEIDFKFDHAMKTADAVITFKQAIKAIVDNLGYMVTFMPK 233 Query: 245 PFFGMNGNGMHCHQSVWFNGEPSFYDPEGPYNGLSETCLSYIAGILSHAKALVAITNPTV 304 PFFG+NG+GMH HQS++ NG+ FYDP+G + LSE +I G+L H+KAL AI PTV Sbjct: 234 PFFGVNGSGMHVHQSLFKNGKNIFYDPDGQ-DQLSEEARYFIGGLLKHSKALSAIVAPTV 292 Query: 305 NSYKRLVPGYEAPVNIAWANKNRSAIIRVPAARGKATRIEFRAPDPTCNPYLAFACMLAA 364 NSYKRLVPGYEAP IA+ KNRS ++R+PA+RG TR+EFR PDP+CNPYLAFA ML + Sbjct: 293 NSYKRLVPGYEAPCYIAYGLKNRSTLVRIPASRGNGTRVEFRCPDPSCNPYLAFAAMLES 352 Query: 365 GLDGIKKKMTAPEPVERNIFKMSEEEKKQLGIESVPANLAAALDELECDEVLQKALGKHI 424 G+DG+ K+ E E ++F + ++ GIE++P++L A LE D+V++ +LG H+ Sbjct: 353 GMDGLNNKIDPGEATEIDVFGLDAAGLEREGIETLPSSLWEAYHALEQDDVVKSSLGDHV 412 Query: 425 YENYMEIKRAEWDDFRTAVTDWETGKYLI 453 Y+ +M+IK+ EWDD+R V +E KYL+ Sbjct: 413 YKQFMDIKKKEWDDYRIQVFPYELEKYLM 441 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 704 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 442 Length adjustment: 33 Effective length of query: 421 Effective length of database: 409 Effective search space: 172189 Effective search space used: 172189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_013646048.1 METBO_RS12305 (type I glutamate--ammonia ligase)
to HMM TIGR00653 (glnA: glutamine synthetase, type I (EC 6.3.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00653.hmm # target sequence database: /tmp/gapView.13615.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00653 [M=462] Accession: TIGR00653 Description: GlnA: glutamine synthetase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-186 605.3 0.0 4.8e-143 463.1 0.0 2.0 2 lcl|NCBI__GCF_000191585.1:WP_013646048.1 METBO_RS12305 type I glutamate-- Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000191585.1:WP_013646048.1 METBO_RS12305 type I glutamate--ammonia ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 141.6 0.0 1.6e-45 1.6e-45 2 136 .. 7 143 .. 6 147 .. 0.95 2 ! 463.1 0.0 4.8e-143 4.8e-143 163 461 .. 144 440 .. 139 441 .. 0.98 Alignments for each domain: == domain 1 score: 141.6 bits; conditional E-value: 1.6e-45 TIGR00653 2 evlkllkeenvkfvdlrfvDikGklkkveipvsele..eealeegiaFDgssveGfksieesDlllkpd 68 +v+++++ + kf++l+fvDi+G++k++++p+s+ e e++l++g+ FDgssv Gf++i+ sDl++kpd lcl|NCBI__GCF_000191585.1:WP_013646048.1 7 KVIENIERCGTKFIRLQFVDIHGTPKNMAVPISKPEdiEDILKDGLLFDGSSVDGFVDINASDLIIKPD 75 578899999**************************9999****************************** PP TIGR00653 69 petlvivPfraek..vlrvicdvyepvtkepyerdpRsiakraeeelktklgdevyfGpEaEFflfdkv 135 p+t++++P+r e+ v+r+icd+y+p +++p+e+dpR+i+k+a+ +++ + g+e+++GpE+EFf++ ++ lcl|NCBI__GCF_000191585.1:WP_013646048.1 76 PDTFSTLPWRPEEkgVCRFICDIYWP-DMTPFEGDPRYILKKALAKIE-DKGYEYNVGPEPEFFIIGED 142 **********99999***********.********************5.99**************9776 PP TIGR00653 136 e 136 lcl|NCBI__GCF_000191585.1:WP_013646048.1 143 A 143 5 PP == domain 2 score: 463.1 bits; conditional E-value: 4.8e-143 TIGR00653 163 nkgykikkkggYfdvepvDkakdirrelvlaleelglevevsHHEvataqaEidikfdklvkaaDeivl 231 + ++ ++++g YfdvepvD+ +d+rrelvl leel++evevsHHEv+++q+Eid+kfd+++k+aD++++ lcl|NCBI__GCF_000191585.1:WP_013646048.1 144 EGHIVPHDNGIYFDVEPVDQGTDVRRELVLGLEELNFEVEVSHHEVGPGQHEIDFKFDHAMKTADAVIT 212 55678899999********************************************************** PP TIGR00653 232 yKyvvknvakkhGktatFmpKplfgdngsGmHvhlslwkdgenlfageegyagLsetalyyigGilkHa 300 +K+++k+++++ G+++tFmpKp+fg ngsGmHvh+sl+k+g+n+f++++g+ +Lse+a+y+igG+lkH+ lcl|NCBI__GCF_000191585.1:WP_013646048.1 213 FKQAIKAIVDNLGYMVTFMPKPFFGVNGSGMHVHQSLFKNGKNIFYDPDGQDQLSEEARYFIGGLLKHS 281 **************************************************999**************** PP TIGR00653 301 kalaAltnptvnsYkRLvpGyEAPvylaysaknRsaliRiPasanpkakRiEvRspDpsanpYLafaal 369 kal+A+++ptvnsYkRLvpGyEAP+y+ay+ knRs+l+RiPas+ ++++R+E+R+pDps+npYLafaa+ lcl|NCBI__GCF_000191585.1:WP_013646048.1 282 KALSAIVAPTVNSYKRLVPGYEAPCYIAYGLKNRSTLVRIPASR-GNGTRVEFRCPDPSCNPYLAFAAM 349 ********************************************.************************ PP TIGR00653 370 lmAgldGiknkidpgepldknlyelseeelkelGieqlpesLeealdelesdkevlkevlgeelieafi 438 l g+dG++nkidpge+++ +++ l+ + l+ Gie+lp+sL+ea+++le+d +v+k+ lg++++++f+ lcl|NCBI__GCF_000191585.1:WP_013646048.1 350 LESGMDGLNNKIDPGEATEIDVFGLDAAGLEREGIETLPSSLWEAYHALEQD-DVVKSSLGDHVYKQFM 417 ****************************************************.**************** PP TIGR00653 439 elkrkEveelrlkvhpvElekyl 461 ++k+kE++++r++v+p+Elekyl lcl|NCBI__GCF_000191585.1:WP_013646048.1 418 DIKKKEWDDYRIQVFPYELEKYL 440 **********************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (462 nodes) Target sequences: 1 (442 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04 # Mc/sec: 4.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory