Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_013682937.1 ARCVE_RS01100 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000194625.1:WP_013682937.1 Length = 413 Score = 312 bits (799), Expect = 3e-89 Identities = 171/408 (41%), Positives = 254/408 (62%), Gaps = 16/408 (3%) Query: 383 EIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPEEYFEGLTEEMKEALDL 442 E + V PI+E VR+ G+ AL+E T++FDGV+L + + + +E + +E+ +AL++ Sbjct: 22 EYIEKVRPIVEKVREGGDEALIELTKQFDGVELQYIRVPSEEIDAAYEEVDDEIIDALEV 81 Query: 443 SIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPA 502 + +N+ +FH+ + ++ VL R+ P++ G+Y+PGG A PSTALM G+PA Sbjct: 82 AKQNIERFHSITCVERDMFIDFGDVVLGKRYV-PLDSAGIYVPGGRASYPSTALMAGIPA 140 Query: 503 QVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVD 562 +A + I +PP + GKV P + + G ++I GGAQA+AA+AYGTE++ VD Sbjct: 141 SIAGVERIAACTPPDER-GKVKPLTLVACDIAGINEIYAVGGAQAIAALAYGTESVKPVD 199 Query: 563 KILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHG 622 KI+GPGN +VTAAK+ V D IDMPAGPSEVL+IADE A+ FVA D L+Q EH Sbjct: 200 KIVGPGNIYVTAAKILVSKDVP----IDMPAGPSEVLIIADETANARFVALDALAQLEH- 254 Query: 623 IDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCIAHSTIVLCDGYEEALEMSN 682 D I V + SEK +E+Q L + + I + D +EA+E+SN Sbjct: 255 -DPMAIAVVLTTSEKLAKEVQSLAEELGKGLN--------LENLRIAVVDSIDEAIEISN 305 Query: 683 QYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGA 742 ++APEHL + A + + + +AGSVFVG Y+P + GDY+SGTNH LPT GY R+YSG Sbjct: 306 KFAPEHLEMMFEGAENCMDRIKHAGSVFVGEYSPVAAGDYASGTNHILPTAGYGRRYSGL 365 Query: 743 NTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRMSK 790 + TF K IT Q ++ +GL+ IG+A++ +A KEGL H +V+ R+ + Sbjct: 366 SVETFLKHITFQKLSKDGLKRIGQAIITLANKEGLPFHAKSVEERLKE 413 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 762 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 413 Length adjustment: 36 Effective length of query: 763 Effective length of database: 377 Effective search space: 287651 Effective search space used: 287651 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory