Align Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.- (characterized)
to candidate WP_013683034.1 ARCVE_RS01615 serine hydroxymethyltransferase
Query= SwissProt::O27433 (423 letters) >NCBI__GCF_000194625.1:WP_013683034.1 Length = 406 Score = 420 bits (1080), Expect = e-122 Identities = 223/412 (54%), Positives = 278/412 (67%), Gaps = 10/412 (2%) Query: 9 EKIRQLMKDHNSWMESSINLIASENITSSRVKEALLSDLSHRYAEGLPGERLYEGCRYID 68 E++ ++++H+ M SS+ LIASEN+TS V+ SDL HRYA G GER YEGC YID Sbjct: 5 EQVFSIIEEHHRLMASSLPLIASENVTSMAVRRCYTSDLGHRYAMGEIGERAYEGCEYID 64 Query: 69 EIEELTIELSKRLFRAEHANVQPTSGVVANLACFFATAEVGDPIMAMEVPYGGHISHARV 128 EIE +EL+KRLF AEHANV+P SG VAN+A + A GD I ++ V GGH SH Sbjct: 65 EIERKAVELTKRLFNAEHANVRPISGTVANIAVYHALTSCGDSIFSLPVECGGHTSHD-- 122 Query: 129 SAAGVRGFQIYTHPFDFENMNIDADAMKKKILEVKPRIILFGGSLFLFPHPVEEALEAAE 188 A +R ++ PFD E NID DA + I EVKPR+I+ G S+FLFPHPV+E +E A Sbjct: 123 DTARIRCLNVHFLPFDSERFNIDIDAASRMIREVKPRLIVLGASVFLFPHPVKEIVEIAA 182 Query: 189 EVGARIMYDGAHVLGLIAGGYFQDPLREGADMLVGSTHKTFPGPQGGIILCREELAADID 248 EVGA ++YD +HVLGLIAG FQDP++EGAD++ STHKTF GPQ IILC+ ELA ID Sbjct: 183 EVGANVIYDASHVLGLIAGKQFQDPVKEGADVVTASTHKTFFGPQRAIILCKSELAEKID 242 Query: 249 EAVFPGLVSNHHLHHVAGLGIATAEMLEFGAEYAAQTINNARKLAENLHELGFNVLCEHL 308 AV P +VSNHHL+ +AG IA EMLEFG YA QT+ NA++LAE L+ELG V+ E Sbjct: 243 YAVMPCVVSNHHLNTLAGYVIACLEMLEFGESYAKQTVRNAKRLAERLYELGMKVVGEAE 302 Query: 309 DFTESHQVVMDVSDIGRAAEISKRLEANNIILNKNLLPWDDVNRSDDPSGIRIGTQEITR 368 FTESHQVV+DV D +AA K LE II N+ LLPW + +GIRIG QE+TR Sbjct: 303 GFTESHQVVIDVDDGEKAA---KTLEKAGIITNRCLLPWSE----GKSAGIRIGVQEVTR 355 Query: 369 RGMKESEMSEVAEYIKRVVMDGKDVRDEVAEFMSSYTRVHYAFEDSEAYKYM 420 GMK EM +AE I + +DG DVR EV E + V Y FE+S AY ++ Sbjct: 356 LGMKGGEMEYIAELISK-ALDGIDVRSEVVELSKQFNTVKYTFEESHAYSFI 406 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 406 Length adjustment: 31 Effective length of query: 392 Effective length of database: 375 Effective search space: 147000 Effective search space used: 147000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory