Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_013683323.1 ARCVE_RS03110 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000194625.1:WP_013683323.1 Length = 333 Score = 268 bits (685), Expect = 2e-76 Identities = 153/345 (44%), Positives = 210/345 (60%), Gaps = 12/345 (3%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEP 103 ++KVGIVGG+GYTG ELLR+L HP+ V +TSR G PV E +P L+G DL F P Sbjct: 1 MVKVGIVGGSGYTGSELLRLLYKHPKAEVVAVTSRKWEGKPVWECHPFLKGFCDLTFVSP 60 Query: 104 DVNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESP 163 ++ CD+VF A PHG AM+ VP+L+ G++VVDLSAD+RL+ DV+ YG+ HE+ Sbjct: 61 EIKNFDGCDIVFTAVPHGEAMKYVPQLLDVGIKVVDLSADYRLQK-DVYEKAYGLEHEA- 118 Query: 164 EWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSGA 223 +AVYGLPE+ RDE+ A LVANPGCYPT L PL + GL++ R++ D+KSG Sbjct: 119 --YREAVYGLPELHRDEVAKADLVANPGCYPTGCILAAAPLAKAGLIE--RVVFDSKSGI 174 Query: 224 SGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIRG 283 +GAG + + + E+ Y + HRH E+ Q + G V V+F P + P RG Sbjct: 175 TGAGIKPTEFTHYPNLHEAIVPYKVTNHRHYYEMVQEI-GELQDGVKVSFTPQVFPGSRG 233 Query: 284 IEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQE 343 I + LK + ++ ++E+ + D FV + + VRG+N C +A+ E Sbjct: 234 ILTNAHIFLKENVSLEEVRRIYEEFYKDCYFVRMQ---NMVRLSWVRGSNFCDIAVFAGE 290 Query: 344 QSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 V+VSS IDNLVKGA+GQA+QNMNIM G E GL+ P L P Sbjct: 291 DR--VVVSSAIDNLVKGASGQAIQNMNIMLGFDEKEGLDFPPLFP 333 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 333 Length adjustment: 29 Effective length of query: 359 Effective length of database: 304 Effective search space: 109136 Effective search space used: 109136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013683323.1 ARCVE_RS03110 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.20384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-127 411.5 0.0 1.6e-127 411.4 0.0 1.0 1 lcl|NCBI__GCF_000194625.1:WP_013683323.1 ARCVE_RS03110 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000194625.1:WP_013683323.1 ARCVE_RS03110 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.4 0.0 1.6e-127 1.6e-127 1 345 [] 2 333 .] 2 333 .] 0.97 Alignments for each domain: == domain 1 score: 411.4 bits; conditional E-value: 1.6e-127 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssre.agkklsevhphlkglvdlkleeleeeeileea 68 +kv+ivG+sGYtG eLlrll kHp++ev+ +v+sr+ +gk++ e+hp lkg+ dl++ + e+++ + + lcl|NCBI__GCF_000194625.1:WP_013683323.1 2 VKVGIVGGSGYTGSELLRLLYKHPKAEVV-AVTSRKwEGKPVWECHPFLKGFCDLTFVSPEIKN-FDGC 68 69***************************.7777777*********************999986.57** PP TIGR01850 69 dvvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnree 137 d+vf+A+phg ++++vp+ll+ g+kv+dlSad+Rl+ ++vYek Yg +he+ ++eavYGlpEl+r+e lcl|NCBI__GCF_000194625.1:WP_013683323.1 69 DIVFTAVPHGEAMKYVPQLLDVGIKVVDLSADYRLQ-KDVYEKAYGLEHEA---YREAVYGLPELHRDE 133 ************************************.77********9999...89************* PP TIGR01850 138 ikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt 206 ++ka+l+anPGCy+T+ +La aPl+k++lie+ +++d+ksG++gAG k++e +++++++e + pYkvt lcl|NCBI__GCF_000194625.1:WP_013683323.1 134 VAKADLVANPGCYPTGCILAAAPLAKAGLIER--VVFDSKSGITGAGIKPTEFTHYPNLHEAIVPYKVT 200 ******************************96..8********************************** PP TIGR01850 207 kHrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvl 275 +HrH E++qe+++l+ + vkvsftp+++p +rGil+ +++ lk++++ ee+r++yee+Y+d fvr++ lcl|NCBI__GCF_000194625.1:WP_013683323.1 201 NHRHYYEMVQEIGELQ-DGVKVSFTPQVFPGSRGILTNAHIFLKENVSLEEVRRIYEEFYKDCYFVRMQ 268 *************887.6899**********************************************98 PP TIGR01850 276 kegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpll 344 + + ++++v+gsnf+di+v e +rvvv saiDNLvKGa+gqA+qn+N+mlgfde+egL++ pl+ lcl|NCBI__GCF_000194625.1:WP_013683323.1 269 N---MVRLSWVRGSNFCDIAVFAGE--DRVVVSSAIDNLVKGASGQAIQNMNIMLGFDEKEGLDFPPLF 332 7...789*************99988..8***************************************99 PP TIGR01850 345 p 345 p lcl|NCBI__GCF_000194625.1:WP_013683323.1 333 P 333 8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.99 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory