Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_013684029.1 ARCVE_RS06800 TrpB-like pyridoxal phosphate-dependent enzyme
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000194625.1:WP_013684029.1 Length = 434 Score = 469 bits (1207), Expect = e-137 Identities = 232/421 (55%), Positives = 305/421 (72%), Gaps = 4/421 (0%) Query: 1 MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGAYFSRIDLLRSILPKEVLRQQFTIERYIK 60 ++ + E +P+ WYNI+PDLPKPLPPP P + L I PKE+++Q+ + ER+I+ Sbjct: 8 VILDPEEMPREWYNILPDLPKPLPPPLHPVTKEPIKPSDLEPIFPKELIKQEMSDERWIR 67 Query: 61 IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK 120 IPEEV + Y + RPTPL RAKRLEE LKTPA+IY+KYEG +P GSHK NTA+ QAY+ Sbjct: 68 IPEEVLEVY-RLWRPTPLIRAKRLEEALKTPAKIYYKYEGVSPPGSHKPNTAVAQAYYNM 126 Query: 121 EEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS 180 +EG+E + TETGAGQWG+A++ A +++MK T++MVKVSY QKP RR +M+ +G V S Sbjct: 127 KEGVERLTTETGAGQWGSALSFATRLFDMKCTVYMVKVSYHQKPYRRILMETWGGEVIPS 186 Query: 181 PTNLTEYGRKILETNPQHPGSLGIAMSEAIEYALKNE-FRYLVGSVLDVVLLHQSVIGQE 239 P++ TE GR+ILE +P + GSLGIA+SEA+E A K+E Y +GSVL+ VLLHQ++IG E Sbjct: 187 PSDRTESGRRILEKDPDNTGSLGIAISEAVEDAAKHENTNYSLGSVLNHVLLHQTIIGLE 246 Query: 240 TITQLDLLGEDADILIGCVGGGSNFGGFTYPFI--GNKKGKRYIAVSSAEIPKFSKGEYK 297 Q +L+ E D+LIGCVGGGSNF GF YPFI K+G R +AV A P + GEY+ Sbjct: 247 AKKQFELIDEKPDVLIGCVGGGSNFAGFCYPFIKDAEKEGIRIVAVEPAACPTLTAGEYR 306 Query: 298 YDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNEREI 357 YD+ D+ GL PL+ M TLG D++PPPI+AGGLRYHG APTLSLL EG++E + Sbjct: 307 YDYGDTVGLTPLLMMYTLGHDFMPPPIHAGGLRYHGDAPTLSLLVAEGVIEAVAVKQIPT 366 Query: 358 FEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESM 417 FEA +F +GIVPAPES HAIR +DEA++A++ E KVI FNLSGHG DL+ Y+ Sbjct: 367 FEAGLLFARTEGIVPAPESNHAIRVAIDEALKAKEEGEEKVIAFNLSGHGYFDLAAYDDY 426 Query: 418 M 418 + Sbjct: 427 L 427 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 434 Length adjustment: 32 Effective length of query: 393 Effective length of database: 402 Effective search space: 157986 Effective search space used: 157986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory