Align Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 (characterized)
to candidate WP_013684058.1 ARCVE_RS06950 ketol-acid reductoisomerase
Query= SwissProt::O28294 (332 letters) >NCBI__GCF_000194625.1:WP_013684058.1 Length = 334 Score = 520 bits (1338), Expect = e-152 Identities = 254/330 (76%), Positives = 287/330 (86%), Gaps = 1/330 (0%) Query: 1 MAKIYRDADADLKYLDGKTVCIIGYGSQGHAHALNLKDSGVNVVVGLPEWDKATWERAEK 60 MAKIY D DADLK L K V IIGYGSQGHAHALNLKDSG++VV+GL + ++ W+RAE+ Sbjct: 1 MAKIYYDKDADLKLLKDKKVAIIGYGSQGHAHALNLKDSGIDVVIGLYKGSRS-WDRAER 59 Query: 61 DGMVVKKLSEAADGADVIAMLIPDMVQPAVYREHIQDKLKEGAMLMFAHGFNIHYNQIVP 120 DG VK++ EA ++VI+MLIPD+VQPAV+ I++ LKEG ML+FAHGFNIHYNQI+P Sbjct: 60 DGFTVKEVDEAVSESNVISMLIPDIVQPAVFYREIKNNLKEGDMLLFAHGFNIHYNQIIP 119 Query: 121 PEYVDVAMVAPKGPGPLVRRMYVEGKGVPSLVAVEQNYTGKALEVALAYAKGIGATRAGV 180 P YVDV MVAPK PG LVRRMY EGKGVP+LVAV +YTGKAL+ ALAYAKGIG TRAGV Sbjct: 120 PSYVDVTMVAPKSPGHLVRRMYEEGKGVPALVAVHSDYTGKALDYALAYAKGIGCTRAGV 179 Query: 181 IETTFKEETETDLFGEQVDLCGGVAEMIKMSFETLVEAGYQPEIAYFEVLHELKLIVDLI 240 IETTFKEETETDLFGEQVDLCGGVAE+IK +FETLVEAGYQPE+AYFE LHELKLIVDLI Sbjct: 180 IETTFKEETETDLFGEQVDLCGGVAELIKATFETLVEAGYQPEVAYFEALHELKLIVDLI 239 Query: 241 YEGGIYNMWSAVSETAKYGGMTRGKRIFTEQTREEMRKILKEIQTGEFAREWILENMAGR 300 YEGGIY MW +VS+TAKYGGMTRGKRI E R+EMRKILKEIQTGEFAREWILEN A R Sbjct: 240 YEGGIYAMWYSVSDTAKYGGMTRGKRIINESVRQEMRKILKEIQTGEFAREWILENQAAR 299 Query: 301 PVYNKLLQMEREHPIEKIGKELRAMMPWLK 330 PV+NKLL+ME+ HPIEK+GKELR MMPWL+ Sbjct: 300 PVFNKLLEMEKNHPIEKVGKELRKMMPWLR 329 Lambda K H 0.318 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 334 Length adjustment: 28 Effective length of query: 304 Effective length of database: 306 Effective search space: 93024 Effective search space used: 93024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013684058.1 ARCVE_RS06950 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.7850.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-151 489.9 0.1 1.5e-151 489.7 0.1 1.0 1 lcl|NCBI__GCF_000194625.1:WP_013684058.1 ARCVE_RS06950 ketol-acid reducto Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000194625.1:WP_013684058.1 ARCVE_RS06950 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 489.7 0.1 1.5e-151 1.5e-151 1 313 [. 15 328 .. 15 329 .. 0.99 Alignments for each domain: == domain 1 score: 489.7 bits; conditional E-value: 1.5e-151 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpD 69 lk+kkvaiiGyGsqG+a+alnl+dsg++v++gl+k++ sw++Ae dGf v++v+ea++++++i +L+pD lcl|NCBI__GCF_000194625.1:WP_013684058.1 15 LKDKKVAIIGYGSQGHAHALNLKDSGIDVVIGLYKGSRSWDRAERDGFTVKEVDEAVSESNVISMLIPD 83 79******************************************************************* PP TIGR00465 70 evqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliA 138 vq++v+ +eik++lkeg++llf+HGfni+++qi +p +vdv++vAPK+pG+lvR++y+eg+Gvp+l+A lcl|NCBI__GCF_000194625.1:WP_013684058.1 84 IVQPAVFYREIKNNLKEGDMLLFAHGFNIHYNQIIPPSYVDVTMVAPKSPGHLVRRMYEEGKGVPALVA 152 ********************************************************************* PP TIGR00465 139 veqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqp 207 v++d+tg+a ++AlayAk+iG +ragv+ettFkeE+e+DLfGEq+ LcGg+++lika+f+tLveaGyqp lcl|NCBI__GCF_000194625.1:WP_013684058.1 153 VHSDYTGKALDYALAYAKGIGCTRAGVIETTFKEETETDLFGEQVDLCGGVAELIKATFETLVEAGYQP 221 ********************************************************************* PP TIGR00465 208 elAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefake 275 e+Ayfe +helklivdl++e+G+ m+ +vs+tAk+g+++++ +i++e++++em+kilkeiq+Gefa+e lcl|NCBI__GCF_000194625.1:WP_013684058.1 222 EVAYFEALHELKLIVDLIYEGGIYAMWYSVSDTAKYGGMTRGkRIINESVRQEMRKILKEIQTGEFARE 290 ******************************************9************************** PP TIGR00465 276 walekeagkpafeearkkekeqeiekvGkelralvkae 313 w+le++a++p f++ ++ek++ iekvGkelr+++++ lcl|NCBI__GCF_000194625.1:WP_013684058.1 291 WILENQAARPVFNKLLEMEKNHPIEKVGKELRKMMPWL 328 ***********************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (334 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.68 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory