Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate WP_013707265.1 DESAC_RS11615 aspartate kinase
Query= SwissProt::Q88EI9 (411 letters) >NCBI__GCF_000195295.1:WP_013707265.1 Length = 412 Score = 462 bits (1188), Expect = e-134 Identities = 236/411 (57%), Positives = 315/411 (76%), Gaps = 1/411 (0%) Query: 1 MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ 60 M LIVQK+GGTSVGS +RI VA +V K G +VVVLSAMSGET+RLI L K++ + Sbjct: 1 MPLIVQKYGGTSVGSPDRIANVANRVVKEWRQGKKMVVVLSAMSGETDRLIKLGKELAEF 60 Query: 61 PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQK 120 P PRELDV+++TGEQVT++L ++ L +G+PA S +Q RI TD ++ +ARI+ ID + Sbjct: 61 PDPRELDVLMATGEQVTVSLFSIYLKSQGIPATSLLSHQARIYTDRAYGRARIIGIDTAR 120 Query: 121 IRADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT 180 IR +LK+GR+V VAGFQGVDE G+ITTLGRGGSDTT VA+AAALKAD C+IYTDV+GV+T Sbjct: 121 IREELKKGRIVTVAGFQGVDEVGNITTLGRGGSDTTAVAIAAALKADLCEIYTDVEGVFT 180 Query: 181 TDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI 240 TDPR+ P+AR+L+KI+++EMLEMASLG+KVL+IRSV FA +YNV L V SF + PGTL+ Sbjct: 181 TDPRICPKARKLDKISYDEMLEMASLGAKVLEIRSVGFAKRYNVRLAVRSSFSDHPGTLV 240 Query: 241 TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVAH 300 T E+E ME ++SG+A+++++A++TI +PD PG+A ++ I+ SNI VDMI+QN + Sbjct: 241 T-TEDEDMENILVSGVAYSKNDARVTITRLPDRPGIASRLFNKIAESNIVVDMIIQNTSI 299 Query: 301 DNTTDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASCM 360 D D TFTV + + K +++ E+G + D IAKVSIVGVGMR++AGVA+ M Sbjct: 300 DGMADITFTVPKGDLRKTLEIIQPLIDELGGGHISSDENIAKVSIVGVGMRNNAGVAAKM 359 Query: 361 FEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLDAPARQGE 411 F +LA+E+INI MISTSEIKVS ++E+KY ELAVR LH AF L+ +GE Sbjct: 360 FSSLARENINIMMISTSEIKVSCIIEDKYTELAVRTLHDAFGLEQSRPRGE 410 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 412 Length adjustment: 31 Effective length of query: 380 Effective length of database: 381 Effective search space: 144780 Effective search space used: 144780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_013707265.1 DESAC_RS11615 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.1749.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-136 441.6 4.6 1.7e-136 441.4 4.6 1.0 1 lcl|NCBI__GCF_000195295.1:WP_013707265.1 DESAC_RS11615 aspartate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195295.1:WP_013707265.1 DESAC_RS11615 aspartate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.4 4.6 1.7e-136 1.7e-136 2 405 .. 2 401 .. 1 403 [. 0.98 Alignments for each domain: == domain 1 score: 441.4 bits; conditional E-value: 1.7e-136 TIGR00656 2 eliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeispr 70 liVqK+GGtsvgs +ri ++a++v+ke ++gkk+vVV+SAms++td+l++l + + + pr lcl|NCBI__GCF_000195295.1:WP_013707265.1 2 PLIVQKYGGTSVGSPDRIANVANRVVKEWRQGKKMVVVLSAMSGETDRLIKLG------KELAEFPDPR 64 59***************************************************......8999****** PP TIGR00656 71 erdelvsvGEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegiivv 139 e d l+++GE+++++l+s l+ +g a++l ++a i Td +g+A+i ++t r+ e L++g iv lcl|NCBI__GCF_000195295.1:WP_013707265.1 65 ELDVLMATGEQVTVSLFSIYLKSQGIPATSLLSHQARIYTDRAYGRARIIGIDT-ARIREELKKGRIVT 132 ******************************************************.************** PP TIGR00656 140 vaGFiGateeGeiTtLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEal 208 vaGF+G +e G+iTtLGRGGSD+tA+++aaalkAd +eiyTDVeGv+ttDPr+ ++a+k+dkisy+E+l lcl|NCBI__GCF_000195295.1:WP_013707265.1 133 VAGFQGVDEVGNITTLGRGGSDTTAVAIAAALKADLCEIYTDVEGVFTTDPRICPKARKLDKISYDEML 201 ********************************************************************* PP TIGR00656 209 elAtlGakvlhpralelaveakvpilvrsskekeegTlitn...kkensslvkaialeknvarltvege 274 e+A+lGakvl r++ +a++++v + vrss++ + gTl+t ++en lv+++a++kn ar+t++ lcl|NCBI__GCF_000195295.1:WP_013707265.1 202 EMASLGAKVLEIRSVGFAKRYNVRLAVRSSFSDHPGTLVTTedeDMENI-LVSGVAYSKNDARVTIT-- 267 ****************************************966555555.*****************.. PP TIGR00656 275 gmlgkrgilaeifkaLaeeeinvdlisqtese...tsislvvdeedvdeakkaLkeesgaaelesleve 340 + +++gi++++f+ +ae++i vd+i+q +s +i+++v + d+ ++ ++++ ++++ +++ + lcl|NCBI__GCF_000195295.1:WP_013707265.1 268 RLPDRPGIASRLFNKIAESNIVVDMIIQNTSIdgmADITFTVPKGDLRKTLEIIQPLIDELGGGHISSD 336 ****************************99877889********************************* PP TIGR00656 341 edlavvsivgaglveapGvaseifkaleekninilmisssetkisvlvdekdaekavrklhekle 405 e++a+vsivg+g++++ Gva+++f+ l+ +nini+mis+se+k+s +++ k++e avr+lh+++ lcl|NCBI__GCF_000195295.1:WP_013707265.1 337 ENIAKVSIVGVGMRNNAGVAAKMFSSLARENINIMMISTSEIKVSCIIEDKYTELAVRTLHDAFG 401 **************************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory