Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_013707423.1 DESAC_RS12415 LL-diaminopimelate aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000195295.1:WP_013707423.1 Length = 388 Score = 292 bits (748), Expect = 1e-83 Identities = 146/382 (38%), Positives = 227/382 (59%), Gaps = 12/382 (3%) Query: 9 KVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHGYS 68 ++K+LP Y+F ++ LK +++ G DI+DLG+G+PD+P + II +L E A P+ H Y Sbjct: 9 RLKQLPPYLFKEIDRLKDEVKARGVDIIDLGVGDPDLPTPRFIIQRLQEAALDPSTHRYP 68 Query: 69 ASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPNPT 128 + G+ R+A+ +Y+RR+GV LDPER + IG+KEG +HL LA PGD +V +P Sbjct: 69 SYSGMNDFREAVVRWYQRRFGVTLDPEREVVTLIGSKEGIAHLPLAFNNPGDLNLVTSPA 128 Query: 129 YPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTS---FRKPKAVVLSFPHNPT 185 YP+++ + G + +P+L E F L DL + S R K + ++P+NPT Sbjct: 129 YPVYHIGTLFAGAHSHFLPLLRENHF-------LPDLSQVSGEVARHAKMLFFNYPNNPT 181 Query: 186 TLCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSK 245 D FF + + ++ I VHD AY ++ +DG+ P S L+V GA +V +E +S+SK Sbjct: 182 GAVADFGFFIQAAEFCREHNIIAVHDAAYTEMAYDGFKPRSFLEVPGAKEVGIEFHSLSK 241 Query: 246 GFSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYR 305 ++M GWR+ F VG +I L +KS +D G F IQ A I AL+S + +N I + Sbjct: 242 SYNMTGWRLGFAVGQADVIAGLGKIKSNIDSGAFNAIQYAGIAALDSDQSSIRENCRILQ 301 Query: 306 RRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVGMNSLDFSLFLLREAKVAVSPGIGFG 365 RRD+L+ GL ++G+ PK + +VW +P G S F+ LL +A + +PG GFG Sbjct: 302 ERRDILISGLRKLGYAAVPPKATFYVW--LPTPTGFTSAQFTGLLLEQAGIVTTPGNGFG 359 Query: 366 EYGEGYVRFALVENEHRIRQAV 387 GEGY+R AL ++ R+ +A+ Sbjct: 360 APGEGYIRLALTVDKSRLEEAL 381 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 388 Length adjustment: 31 Effective length of query: 371 Effective length of database: 357 Effective search space: 132447 Effective search space used: 132447 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory