Align isopropylmalate/citramalate isomerase large subunit LeuC (EC 4.2.1.33; EC 4.2.1.35) (characterized)
to candidate WP_013707452.1 DESAC_RS12565 3-isopropylmalate dehydratase large subunit
Query= reanno::DvH:208495 (419 letters) >NCBI__GCF_000195295.1:WP_013707452.1 Length = 421 Score = 493 bits (1269), Expect = e-144 Identities = 242/416 (58%), Positives = 296/416 (71%) Query: 4 TLAQKILQRHTDEAITDAGQIVRCRVSMVLANDITAPLAIKSFRAMGAKRVFDKDRVALV 63 T+ +KIL H + GQ++ RV + L NDITAP+AIK FR GA +V+D +RV LV Sbjct: 6 TITEKILAAHAGLDYVEPGQLINARVDIALGNDITAPIAIKEFRQAGALKVYDPERVVLV 65 Query: 64 MDHFTPQKDIEAAQQVKLTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVVGAD 123 DHF P KDI +A Q + R FA+E + HYY+GG+ GVEHALLPE G+VGPGD+V+GAD Sbjct: 66 ADHFAPNKDIPSAIQCQTLRRFAQEQKLRHYYDGGEMGVEHALLPEKGIVGPGDLVIGAD 125 Query: 124 SHTCTYGGLGAFATGLGSTDVAGAMALGETWFKVPPTIRATFTGTLPAYVGAKDLILTLI 183 SHTCTYGGLGAFATG+GSTD+A M GE+WFKVP T+ FTG LP +VG KDLIL LI Sbjct: 126 SHTCTYGGLGAFATGVGSTDLAATMITGESWFKVPETMLFIFTGQLPQWVGGKDLILFLI 185 Query: 184 GAIGVDGALYRALEFDGAAIEALDVEGRMTMANMAIEAGGKAGLFAADAKTLTYCTTAGR 243 G IGVDGALY A+EF G + L + R+TM NMAIEAG K G+ A D T Y Sbjct: 186 GQIGVDGALYNAMEFTGEVVARLPMSDRLTMCNMAIEAGAKNGIIAPDDITREYVANRAL 245 Query: 244 TGDTAFSADAGAVYERELSFDVTGMTPVVACPHLPDNVKPVSEVKDVTVQQVVIGSCTNG 303 T F++D GA Y +DV+GM P +A PHLP+N P+S+V V + Q VIGSCTNG Sbjct: 246 RAVTFFASDPGANYHSVREYDVSGMEPQIAFPHLPENTHPLSQVGAVPIDQAVIGSCTNG 305 Query: 304 RIGDLREAAAVLRGRKVSRDVRCIVLPATPGIWRQALREGLIETFMEAGCIVGPATCGPC 363 R+ D+R AA VL+GRKV+R VR I++PATP I+RQ L+EGL E F++AG ++ P TCGPC Sbjct: 306 RLEDMRLAAQVLKGRKVARGVRLIIIPATPWIYRQCLKEGLFEIFLDAGAVISPPTCGPC 365 Query: 364 LGGHMGILADGERAIATTNRNFKGRMGSLESEVYLSGPATAAASAVTGVITDPSTL 419 LGGHMG+L GE AIATTNRNF GRMG ES++YL+ PA AASAV G I P L Sbjct: 366 LGGHMGVLGPGETAIATTNRNFVGRMGHPESKLYLANPAVTAASAVAGRIVGPQAL 421 Lambda K H 0.320 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 29 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 421 Length adjustment: 32 Effective length of query: 387 Effective length of database: 389 Effective search space: 150543 Effective search space used: 150543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_013707452.1 DESAC_RS12565 (3-isopropylmalate dehydratase large subunit)
to HMM TIGR02083 (leuC: 3-isopropylmalate dehydratase, large subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02083.hmm # target sequence database: /tmp/gapView.20471.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02083 [M=419] Accession: TIGR02083 Description: LEU2: 3-isopropylmalate dehydratase, large subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-208 677.6 0.0 3.7e-208 677.5 0.0 1.0 1 lcl|NCBI__GCF_000195295.1:WP_013707452.1 DESAC_RS12565 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195295.1:WP_013707452.1 DESAC_RS12565 3-isopropylmalate dehydratase large subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 677.5 0.0 3.7e-208 3.7e-208 1 418 [. 5 420 .. 5 421 .] 1.00 Alignments for each domain: == domain 1 score: 677.5 bits; conditional E-value: 3.7e-208 TIGR02083 1 mtlaekiladkagkeevkpgelilakldlvlgndvttplaikafkelgvkkvfdkdkvalvldhftpnk 69 mt++ekila +ag+++v+pg+li a++d++lgnd+t+p+aik+f+++g+ kv+d+++v+lv dhf+pnk lcl|NCBI__GCF_000195295.1:WP_013707452.1 5 MTITEKILAAHAGLDYVEPGQLINARVDIALGNDITAPIAIKEFRQAGALKVYDPERVVLVADHFAPNK 73 9******************************************************************** PP TIGR02083 70 dikaaeqvklirefakekeiekyfeigelgvehallpekglvvsgdliigadshtctygalgafatgvg 138 di +a q++ +r+fa+e+++++y++ ge+gvehallpekg+v +gdl+igadshtctyg lgafatgvg lcl|NCBI__GCF_000195295.1:WP_013707452.1 74 DIPSAIQCQTLRRFAQEQKLRHYYDGGEMGVEHALLPEKGIVGPGDLVIGADSHTCTYGGLGAFATGVG 142 ********************************************************************* PP TIGR02083 139 stdlavamatgkawfkvpeaikfvlkgklkdyvsakdlilkiigkigvdgalykslefsgeglkelsvd 207 stdla++m+tg++wfkvpe++ f + g+l ++v +kdlil +ig+igvdgaly ++ef+ge++ +l + lcl|NCBI__GCF_000195295.1:WP_013707452.1 143 STDLAATMITGESWFKVPETMLFIFTGQLPQWVGGKDLILFLIGQIGVDGALYNAMEFTGEVVARLPMS 211 ********************************************************************* PP TIGR02083 208 drltianmaieagaktgifevdektieyvkgrakrelkiykadedakyervieidlselepqvafphlp 276 drlt++nmaieagak+gi+ +d++t eyv +ra r + + +d a+y+ v e+d+s +epq+afphlp lcl|NCBI__GCF_000195295.1:WP_013707452.1 212 DRLTMCNMAIEAGAKNGIIAPDDITREYVANRALRAVTFFASDPGANYHSVREYDVSGMEPQIAFPHLP 280 ********************************************************************* PP TIGR02083 277 entkeideaekeeikidqvvigsctngrledlrlaaeilkgkkvakevrliilpasqkvylealkegll 345 ent+++++++ + idq+vigsctngrled+rlaa++lkg+kva+ vrlii+pa++ +y ++lkegl lcl|NCBI__GCF_000195295.1:WP_013707452.1 281 ENTHPLSQVG--AVPIDQAVIGSCTNGRLEDMRLAAQVLKGRKVARGVRLIIIPATPWIYRQCLKEGLF 347 **********..9******************************************************** PP TIGR02083 346 eifieagavvstptcgpclgghmgilaegeravsttnrnfvgrmghpksevylaspavaaasaikgkia 414 eif++agav+s+ptcgpclgghmg+l ge a++ttnrnfvgrmghp+s++yla pav+aasa++g+i+ lcl|NCBI__GCF_000195295.1:WP_013707452.1 348 EIFLDAGAVISPPTCGPCLGGHMGVLGPGETAIATTNRNFVGRMGHPESKLYLANPAVTAASAVAGRIV 416 ********************************************************************* PP TIGR02083 415 spee 418 p+ lcl|NCBI__GCF_000195295.1:WP_013707452.1 417 GPQA 420 **86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (419 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.02 # Mc/sec: 6.37 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory