Align Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 (characterized)
to candidate WP_013707722.1 DESAC_RS14005 imidazoleglycerol-phosphate dehydratase HisB
Query= SwissProt::Q8ABA7 (374 letters) >NCBI__GCF_000195295.1:WP_013707722.1 Length = 194 Score = 150 bits (378), Expect = 4e-41 Identities = 82/192 (42%), Positives = 115/192 (59%), Gaps = 3/192 (1%) Query: 185 KAEVRRTTKETDIYVSLNLDGNGGCDISTGLGFFDHMLEQIGKHSGMDLTIRVKGDLEVD 244 ++ + RTT+ETDI + L LDG+G +I +G+ F DHML H DL +R KGDLEVD Sbjct: 4 QSRIARTTRETDIVLELRLDGSGQVEIDSGIPFLDHMLHLFAAHGFFDLNLRAKGDLEVD 63 Query: 245 EHHTIEDTAIALGECIYQALGSKRGIERYGYA-LPMDDCLCQVCLDFGGRPWLVWDAEFN 303 +HHT+ED I LG+ QAL +RYG+A +PMD+ + QV +D RP+LV++ F Sbjct: 64 DHHTVEDIGICLGQAFRQALQVLPRFKRYGFARVPMDEAVAQVTVDLSNRPFLVYNVNFL 123 Query: 304 REKIGEMPTEMFLHFFKSLSDAAKMNLNIKAE-GQNEHHKIEGIFKALARALKMALKRDI 362 G ++ F+++ + M L+I+A G+N HH IE IFKA RAL A + Sbjct: 124 AGG-GRFDPQLVKEFWRATAQHGGMTLHIEAPYGENTHHLIEAIFKAAGRALDQATLPEP 182 Query: 363 YHFELPSSKGVL 374 PS+KGVL Sbjct: 183 RLSGTPSTKGVL 194 Lambda K H 0.321 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 194 Length adjustment: 25 Effective length of query: 349 Effective length of database: 169 Effective search space: 58981 Effective search space used: 58981 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory