Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_013722033.1 ALIDE2_RS09890 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000204645.1:WP_013722033.1 Length = 366 Score = 290 bits (743), Expect = 3e-83 Identities = 159/361 (44%), Positives = 220/361 (60%), Gaps = 10/361 (2%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIME 66 L LRV+IDSLD ++L L+++RAR A++V +K K E F+RP+R A V++ I Sbjct: 11 LADLRVQIDSLDHQLLQLVNQRARVAEQVGELK-----KREGTPFFRPDRVAQVIEKIQG 65 Query: 67 LNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAA 126 N GPL N +A ++REIMS+CLALE P RVA LGPEGTF + AA+++FG + + Sbjct: 66 ANPGPLKNAHVAAIWREIMSACLALESPQRVAVLGPEGTFCEQAAIEYFGGAADLMYCNS 125 Query: 127 IDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETT 186 DEVF AG+ +GVV VENS EG V +LD FL + GEV L I H+LL Sbjct: 126 FDEVFHATAAGSAQYGVVGVENSNEGVVTRSLDMFLHTPCHVVGEVSLLIRHNLL-RSVN 184 Query: 187 KTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQ 246 + I + +H Q+LAQC WL H P+ ER VSSNA+ A+ + A I+ + AAQ Sbjct: 185 SAEGIEAVLAHPQALAQCHAWLAKHLPHAERRPVSSNAEGARLAATNPAWAGISSERAAQ 244 Query: 247 LYGLSKLAEKIEDRPVNSTRFLIIGSQEV----PPTGDDKTSIIVSMRNKPGALHELLMP 302 YGL +A I+D N TRF II PTG D TS+I+S+ N+PGA+H+LL+P Sbjct: 245 QYGLHVVAHAIQDDAYNRTRFAIICLPHTLATPAPTGRDCTSLIISVPNRPGAVHDLLVP 304 Query: 303 FHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPK 362 +G+ +TR E+RP+R+G+W Y F+ID GH + + L ++ K+LG+YP Sbjct: 305 LKKHGVSMTRFESRPARTGQWEYYFYIDLEGHPAEANVAAALAELQQLCAFYKLLGTYPV 364 Query: 363 A 363 A Sbjct: 365 A 365 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 366 Length adjustment: 30 Effective length of query: 335 Effective length of database: 336 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013722033.1 ALIDE2_RS09890 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.7949.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-31 93.4 0.1 8.1e-31 92.5 0.1 1.5 1 lcl|NCBI__GCF_000204645.1:WP_013722033.1 ALIDE2_RS09890 prephenate dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013722033.1 ALIDE2_RS09890 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.5 0.1 8.1e-31 8.1e-31 1 76 [] 11 84 .. 11 84 .. 0.99 Alignments for each domain: == domain 1 score: 92.5 bits; conditional E-value: 8.1e-31 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavari 71 L++lR++iD++D+++l+L+++Ra++a++vgelKk+ ++++++RP+R a+v+ +++++n+GpL++ va+i lcl|NCBI__GCF_000204645.1:WP_013722033.1 11 LADLRVQIDSLDHQLLQLVNQRARVAEQVGELKKR--EGTPFFRPDRVAQVIEKIQGANPGPLKNAHVAAI 79 789********************************..********************************** PP TIGR01807 72 frEim 76 +rEim lcl|NCBI__GCF_000204645.1:WP_013722033.1 80 WREIM 84 ****9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory