Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (uncharacterized)
to candidate WP_013722206.1 ALIDE2_RS12495 histidinol dehydrogenase
Query= curated2:Q9RH05 (430 letters) >NCBI__GCF_000204645.1:WP_013722206.1 Length = 439 Score = 279 bits (713), Expect = 1e-79 Identities = 162/411 (39%), Positives = 238/411 (57%), Gaps = 5/411 (1%) Query: 23 RRESEGDVSRDVSAIIADVKKRGDVAIAELTQKFDRHDLNKGGWQLTQEEIKKACDSLPS 82 R E + V V II D++ RGD A+ E ++KFD+ D ++L+Q EI A SL + Sbjct: 14 RAEEDAKVRATVECIIKDIELRGDEAVREYSRKFDQWD--PADFRLSQAEIDAARKSLSA 71 Query: 83 ELMDALKLAATRIRYCHENQLPESS--EMTDAAGVRMGVRWQAVEAAGLYVPGGRAAYCS 140 ++ + A ++R + Q E+ GV +G + V A G Y+PGG+ + Sbjct: 72 REIEDIAFAQKQVRNFAQIQRDSMKDVEVQTHPGVILGHKHLPVNAVGCYIPGGKYPLLA 131 Query: 141 SVLMNAVPAKVAGVKRLVMVTPTPDGFVNPAVIAAAVISEVDEIWKIGGAQAVAALALGT 200 S M+ + AKVAGV+R+V P G +PA++ A ++ DEI +GG QAV A+A+GT Sbjct: 132 SAHMSVLTAKVAGVRRVVSTAPPFQGKPHPAIVTAMHMAGADEILVLGGVQAVVAMAVGT 191 Query: 201 EKIKPVDVVVGPGNAWVAEAKRQLYGQVGIDMVAGPSEIVVVADKDNDPEWLAADLLSQA 260 + I PVD++VGPGN +VAEAKRQL+G+VGID+ AGP+E +V+AD+ D E A DLL QA Sbjct: 192 QSIAPVDMLVGPGNMFVAEAKRQLFGRVGIDLFAGPTETLVIADESVDAEMCAVDLLGQA 251 Query: 261 EHDPTSQSILISDSEDLIEKTIEAVGRRLEKLETQKVARESWDKHGATILVQSLDEAPAL 320 EH PTS ++L++ SE L ++T+ V R+L L T +A +SW ++G I+ S E Sbjct: 252 EHGPTSPAVLLTTSEKLAKETMAEVERQLRILPTAAIAAQSWAEYGEVIVCDSDAEMLEK 311 Query: 321 VDRLAPEHLELAVADPDALFANVHHSGSVFLGRYTPEAIGDYVGGPNHVLPTGRRARFSS 380 D LA EH+++ DPD + + G++FLG T + GD V G NH LPT + AR++ Sbjct: 312 ADALASEHVQVMTRDPDYFLNRLSNYGALFLGPRTNVSFGDKVIGTNHTLPTNKAARYTG 371 Query: 381 GLSVIDFMKRTTYLN-CSQEALSKIGPAAVTLAKAEGLPAHAESVISRLNK 430 GL V F+K TY + EA + +G L E H E R+ + Sbjct: 372 GLWVGKFLKTCTYQKVLTDEASALMGEYCSRLCHMENFVGHGEQANLRVRR 422 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 30 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 439 Length adjustment: 32 Effective length of query: 398 Effective length of database: 407 Effective search space: 161986 Effective search space used: 161986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_013722206.1 ALIDE2_RS12495 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.10168.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-139 449.0 0.1 1e-138 448.8 0.1 1.0 1 lcl|NCBI__GCF_000204645.1:WP_013722206.1 ALIDE2_RS12495 histidinol dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013722206.1 ALIDE2_RS12495 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.8 0.1 1e-138 1e-138 1 393 [] 25 419 .. 25 419 .. 0.97 Alignments for each domain: == domain 1 score: 448.8 bits; conditional E-value: 1e-138 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlp 69 v+ ii+d++ +GdeA++ey++kfd+++++++r+s++e+++a+++++++ +e+++ a++++++f++ q++ lcl|NCBI__GCF_000204645.1:WP_013722206.1 25 VECIIKDIELRGDEAVREYSRKFDQWDPADFRLSQAEIDAARKSLSAREIEDIAFAQKQVRNFAQIQRD 93 788**************************************************************9996 PP TIGR00069 70 es..veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnp 136 + vev+t++gv+lg+k p+++vg+Y+PgGk+++++++ m +++AkvAgv+++v ++Pp +gk +p lcl|NCBI__GCF_000204645.1:WP_013722206.1 94 SMkdVEVQTHPGVILGHKHLPVNAVGCYIPGGKYPLLASAHMSVLTAKVAGVRRVVSTAPPF-QGKPHP 161 64459********************************************************6.9***** PP TIGR00069 137 avlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEv 205 a+++a++++g+de++ +GG+qa+ a+a Gt+++ +vd++vGPGn++V++AK+++fg+vgid++aGP+E lcl|NCBI__GCF_000204645.1:WP_013722206.1 162 AIVTAMHMAGADEILVLGGVQAVVAMAVGTQSIAPVDMLVGPGNMFVAEAKRQLFGRVGIDLFAGPTET 230 ********************************************************************* PP TIGR00069 206 lviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaekslekngai 274 lviades ++e++a+Dll qaEH++++ a+l+ttse+la+++ +eve+ql+ l+++ ia +s++++g++ lcl|NCBI__GCF_000204645.1:WP_013722206.1 231 LVIADESVDAEMCAVDLLGQAEHGPTSPAVLLTTSEKLAKETMAEVERQLRILPTAAIAAQSWAEYGEV 299 ********************************************************************* PP TIGR00069 275 ilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtAr 343 i++d+ +e+le ++++A EH++++t+dp +l++++n+G++flG+ t +++gd+v G+nh+LPT+++Ar lcl|NCBI__GCF_000204645.1:WP_013722206.1 300 IVCDSDAEMLEKADALASEHVQVMTRDPDYFLNRLSNYGALFLGPRTNVSFGDKVIGTNHTLPTNKAAR 368 ********************************************************************* PP TIGR00069 344 fasglsvedFlkrisvqelsk.ealeelaeaveklaeaEgLeaHaeavevR 393 +++gl+v +Flk++++q++ ea + ++e +++l+++E++ H e ++ R lcl|NCBI__GCF_000204645.1:WP_013722206.1 369 YTGGLWVGKFLKTCTYQKVLTdEASALMGEYCSRLCHMENFVGHGEQANLR 419 *****************986505556678999*************998877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (439 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory