Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_013722895.1 ALIDE2_RS18660 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000204645.1:WP_013722895.1 Length = 317 Score = 98.2 bits (243), Expect = 2e-25 Identities = 76/263 (28%), Positives = 124/263 (47%), Gaps = 18/263 (6%) Query: 3 PDLQLALELAEKAGKL----TLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKF 58 P L +A++ A AG + LD ++++ K+ + VTE D+ AE+ I + + + Sbjct: 7 PMLNVAIKAARAAGAIINRAALDV---EAVRISQKQINDFVTEVDQGAEQAIIETLLTAY 63 Query: 59 PDDGLFGEEF-DEHPSGNGRR-WIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINF 116 P G+ EE +H S + WIIDP+DGT +FIHG P+Y V IAL V+G ++ V+ Sbjct: 64 PGHGILAEESGSQHGSKHSEYVWIIDPLDGTTNFIHGFPVYCVSIALAVKGKVEHAVVYD 123 Query: 117 PALGELYQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHP------VDQ 170 P +L+ A RG GAF+N ++VS + + P N + Sbjct: 124 PTRNDLFTATRGRGAFLNDRRIRVSKRTRLGDCLI---STGFPFRPGDNFKQYMAMMAEL 180 Query: 171 LRIDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQS 230 + AGL R VA+G + + +S WD AA +V EAGG ++ G Sbjct: 181 MPRTAGLRRPGAAALDLAYVAAGYCDGFFEAGLSIWDVAAGGLLVTEAGGLVGNFTGEAD 240 Query: 231 IIDGEGLVSANNAMGRNLIAAIG 253 ++ ++ + L+ +G Sbjct: 241 YLEQRECLAGAPRIYGQLVGLLG 263 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 317 Length adjustment: 26 Effective length of query: 233 Effective length of database: 291 Effective search space: 67803 Effective search space used: 67803 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory