Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_013723150.1 ALIDE2_RS21745 type 1 glutamine amidotransferase
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000204645.1:WP_013723150.1 Length = 190 Score = 265 bits (677), Expect = 4e-76 Identities = 132/191 (69%), Positives = 154/191 (80%), Gaps = 5/191 (2%) Query: 2 LLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAGV 61 LLMIDNYDSFTYN+VQY GEL AEV+V RNDE+++E I A AP+R+V+SPGPC+P EAGV Sbjct: 4 LLMIDNYDSFTYNIVQYLGELGAEVEVFRNDEITLEGIAARAPDRLVISPGPCSPAEAGV 63 Query: 62 SLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLANP 121 S+A I+ FAG+LP+LGVCLGHQSIG AFGG +VRA+++MHGKTS I GVFAGL Sbjct: 64 SVAAIQHFAGRLPILGVCLGHQSIGAAFGGRIVRAQELMHGKTSVITTTQKGVFAGLPRQ 123 Query: 122 LTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTEQ 181 TV RYHSL ++R S PE LE+TAWT DG EIMGVRHKTL +EGVQFHPESILTE Sbjct: 124 FTVNRYHSLSIERASCPEVLEITAWTD--DG---EIMGVRHKTLPIEGVQFHPESILTEH 178 Query: 182 GHELLANFLRQ 192 GH +L NFL Q Sbjct: 179 GHAMLKNFLEQ 189 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 190 Length adjustment: 20 Effective length of query: 181 Effective length of database: 170 Effective search space: 30770 Effective search space used: 30770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate WP_013723150.1 ALIDE2_RS21745 (type 1 glutamine amidotransferase)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.7822.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-81 258.8 0.0 1.8e-81 258.6 0.0 1.0 1 lcl|NCBI__GCF_000204645.1:WP_013723150.1 ALIDE2_RS21745 type 1 glutamine Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204645.1:WP_013723150.1 ALIDE2_RS21745 type 1 glutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 258.6 0.0 1.8e-81 1.8e-81 2 191 .. 4 188 .. 3 189 .. 0.98 Alignments for each domain: == domain 1 score: 258.6 bits; conditional E-value: 1.8e-81 TIGR00566 2 vllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaisslelieh 70 +l+idnydsftyn+vq+l elgaev v rnd++tl+ i a +p+ +visPGPc+P+ea++s +++i+h lcl|NCBI__GCF_000204645.1:WP_013723150.1 4 LLMIDNYDSFTYNIVQYLGELGAEVEVFRNDEITLEGIAARAPDR-LVISPGPCSPAEAGVS-VAAIQH 70 89*******************************************.****************.****** PP TIGR00566 71 laGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveae 139 +aG+lPilGvClGhq+++ afG+ +vra++++hGk+s i+ +++vfagl P+ +++ ryhsl +e + lcl|NCBI__GCF_000204645.1:WP_013723150.1 71 FAGRLPILGVCLGHQSIGAAFGGRIVRAQELMHGKTSVITTTQKGVFAGL--PRQFTVNRYHSLSIERA 137 **************************************************..777************** PP TIGR00566 140 tldtllevtaleeeeieimairhrdlpleGvqfhPesilselGkellanflk 191 + +++le+ta+++ eim++rh+ lp+eGvqfhPesil+e+G+++l+nfl+ lcl|NCBI__GCF_000204645.1:WP_013723150.1 138 SCPEVLEITAWTDDG-EIMGVRHKTLPIEGVQFHPESILTEHGHAMLKNFLE 188 *************99.**********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (190 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory