Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_013817476.1 METME_RS03820 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000214665.1:WP_013817476.1 Length = 408 Score = 328 bits (841), Expect = 3e-94 Identities = 180/405 (44%), Positives = 267/405 (65%), Gaps = 4/405 (0%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 ++ V KFGG ++ VE+++ VAEK+ K +G + VVV+SAM T+ L+ LAK + P Sbjct: 2 ALYVYKFGGTSVGTVERIKAVAEKVKKSHDAGDQIVVVVSAMSGETNRLVALAKEMQVQP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 RELD+LLSTGE ++AL+S+AL G A S+TG Q+KI+TD + ARI +I+ + Sbjct: 62 TDRELDVLLSTGEQVTIALLSMALHNVGVDARSYTGAQVKILTDSAHTKARIREIDEANM 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 L + VVAGFQG+ E G+ITTLGRGGSD T +ALA +L AD C +Y DVDGVYT Sbjct: 122 RADLDAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECHIYTDVDGVYTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLI- 577 DPR+V AR ++++++EEM+E++ G++VLQ R+ EFA KY VK+ + ++ E GTLI Sbjct: 182 DPRVVPKARRLEQITFEEMLEMASLGSKVLQIRSVEFAGKYNVKLRVLSSFMEGNGTLIT 241 Query: 578 WEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMKSGE 637 +E +++E ++ + F AK+ L VPD PGVA++I+ ++ + +DMI+Q + + Sbjct: 242 YEESEMERALISGIAFNRDEAKLTLTGVPDLPGVASKILGPVAAENIEVDMIVQNISAHG 301 Query: 638 YNTVAFIVPESQLGKLDIDLLKTRSEA---KEIIIEKGLAKVSIVGVNLTSTPEISATLF 694 F V + + L R+E +II + + KVSIVGV + S I++T+F Sbjct: 302 TTDFTFTVNRNDFARAKSVLEGLRNELGGNTQIIGDNSIVKVSIVGVGMRSHAGIASTMF 361 Query: 695 ETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE 739 +TLA+EGINI MIS S +ISV++D KY+E AV+A+H F+LD+E Sbjct: 362 KTLADEGINIQMISTSEIKISVVVDEKYLELAVRALHKAFDLDQE 406 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 714 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 408 Length adjustment: 36 Effective length of query: 703 Effective length of database: 372 Effective search space: 261516 Effective search space used: 261516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory