Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate WP_013817912.1 METME_RS06135 pyridoxal-dependent decarboxylase, exosortase A system-associated
Query= curated2:O67262 (420 letters) >NCBI__GCF_000214665.1:WP_013817912.1 Length = 411 Score = 171 bits (434), Expect = 3e-47 Identities = 128/399 (32%), Positives = 204/399 (51%), Gaps = 26/399 (6%) Query: 17 ELFIEGVSLKELAQTFG-TPLYVYSSNFIKERFEAYRKAFPDAL-ICYAVKANFNPHLVK 74 EL + G SL LA+ G TP Y Y + R + R+A P L I YA+KAN P +V+ Sbjct: 20 ELMVGGTSLSRLAERVGQTPFYAYDRQALTRRMQQLRQAMPPELKIHYAMKANPMPAVVQ 79 Query: 75 LLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFNVESRQE 134 + L G D+ S E+ +A +P E I +AG GK +EL+ A+ + + + N+ES E Sbjct: 80 HMATLADGFDLASADEMKVALDTPMPAEHISFAGPGKRPQELSQAIAAGVTI-NIESAHE 138 Query: 135 LDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQ----KSKFGVDIREAQKEYEYA 190 L+ + + LG A++A+R+NP + K A+GM+ +FG+D + + Sbjct: 139 LECIGKQCENLGVNAKVAVRINPAFELK-----ASGMKMGGGAKQFGIDEEQVPVILQRI 193 Query: 191 SKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQK-GFDIKYLDIGGGLGIKY 249 L+ L+ G H + GSQ L EA +K + L +L+ I+ L+IGGG GI Y Sbjct: 194 KTLD-LQFQGFHIYSGSQNLKADSIIEAQQKSLQLAANLSPLCPSPIRKLNIGGGFGIPY 252 Query: 250 KPEDKEPAPQDLADLLKDLL-----ENVKAKIILEPGRSIMGNAGILITQVQFLKDKGSK 304 P D A + + + L L +A+II+E GR ++G AGI +T++ K + Sbjct: 253 FPGDAPLAIEQVGNALASELVLTRQSLAEAEIIIELGRYLVGEAGIYVTRILDKKISRGQ 312 Query: 305 HFIIVDAGMNDLIRPS------IYNAYHHIIPVETKERKKVVADIVGPICETGDFLALDR 358 F++VD G++ + S I Y I + ++ +IVGP+C D LA Sbjct: 313 TFLVVDGGLHHHLAASGNFGQVIRKNYPVAIGNKMGVQELETVNIVGPLCTPLDILADKM 372 Query: 359 EIEEVQRGEYLAVLSAGAYGFAMS-SHYNMRPRAAEVLV 396 + + + G+ + + +GAYG+ S S + +P A EVLV Sbjct: 373 TLPKAEIGDLVVIFQSGAYGYTASPSKFLSQPDAREVLV 411 Lambda K H 0.317 0.139 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 420 Length of database: 411 Length adjustment: 31 Effective length of query: 389 Effective length of database: 380 Effective search space: 147820 Effective search space used: 147820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory