Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_013834671.1 THICY_RS00550 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_000214825.1:WP_013834671.1 Length = 443 Score = 127 bits (320), Expect = 5e-34 Identities = 94/299 (31%), Positives = 143/299 (47%), Gaps = 28/299 (9%) Query: 33 GSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVS-NVFTNEPALRLAH 91 G + GR+L+D + G+ HP ++AA +EQ K+ H+ F+++PA LA Sbjct: 32 GCTITLDDGRQLLDAMSSWWSAIHGYNHPTIIAAASEQLQKMPHIMFGGFSHQPATELAQ 91 Query: 92 KLVDAT--FAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEIVAALNSFHGRTLFTV 149 L+D + FF +SG+ A E A K+A + K +A +++HG T + Sbjct: 92 ALIDISPPSLTHTFFADSGSIAVEVALKMALQYWKSIGQPRKSRFIALQHAYHGDTFGAM 151 Query: 150 NV-----GGQSKYSDGFGP----KITGITHVPYN---------DLAALKAAVSDKTCAVV 191 +V G ++D P K I H P LA + + A + Sbjct: 152 SVCDPVDGMHHLFADNLMPNLFAKAPPICHHPSEPLDNQACLASLAQILEQHHHEIAAFI 211 Query: 192 LEPI-QGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLFAYQHYGVTPDI 250 EPI QG GG+ YL+ A LC ++ LL+ DE+ TG+GR+GKLFA + + PDI Sbjct: 212 FEPIVQGAGGMRFYSADYLKEAAALCRHYDVLLIADEIATGLGRTGKLFACEWADIEPDI 271 Query: 251 LTSAKSLGGG-FPIAAMLTTEDLAKHLVVGT-----HGTTYGGNPLACAVAEAVIDVIN 303 LT K L G +AA+L E + + HG T+ NPLAC +A A + ++N Sbjct: 272 LTLGKGLSAGMISLAAVLCNERIRAGISQAAPGLLMHGPTFMANPLACRIAHASVKLLN 330 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 443 Length adjustment: 32 Effective length of query: 374 Effective length of database: 411 Effective search space: 153714 Effective search space used: 153714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory