Align Homoserine O-acetyltransferase; HAT; EC 2.3.1.31; Homoserine transacetylase; HTA (uncharacterized)
to candidate WP_013834891.1 THICY_RS01725 homoserine O-acetyltransferase
Query= curated2:Q1QQD3 (399 letters) >NCBI__GCF_000214825.1:WP_013834891.1 Length = 377 Score = 380 bits (975), Expect = e-110 Identities = 188/364 (51%), Positives = 251/364 (68%), Gaps = 8/364 (2%) Query: 24 TSQVAMFAGDQPLPLDCGIDLAPFQIAYQTYGELNAGKSNAILVCHALTGDQHVANVHPV 83 T QV+M PL L G +L + + Y+TYGELNA SNA+L+CHAL+GD HV + Sbjct: 11 TLQVSM-----PLQLVSGAELPSYDLVYETYGELNADASNAVLICHALSGDHHVTGYYEG 65 Query: 84 TGKPGWWVTLVGPGKPLDTDKYFVICSNVIGGCMGSTGPASTNPATGTVWGLDFPVITIP 143 KPGWW +GPGKP+DT+++FV+CSN +GGC GS+GPAS NPATG V+G DFP++T Sbjct: 66 DTKPGWWSDYIGPGKPVDTNEFFVVCSNNLGGCRGSSGPASLNPATGKVYGPDFPIVTCR 125 Query: 144 DMVRAQAMLIDRLGIDTLFSVVGGSMGGMQVLQWCVAYPQRVFSALPIACSTRHSAQNIA 203 D V +Q L LGI+ +V+GGSMGGMQV+QW + +P ++ AL IA + + SAQNIA Sbjct: 126 DWVNSQNTLRQHLGIEQWAAVIGGSMGGMQVMQWAIDHPDKLRHALVIAAAPKLSAQNIA 185 Query: 204 FHELGRQAVMADPDWRDGRYVEQGTYPHRGLGVARMAAHITYLSDAALHRKFGRRMQDRD 263 F+E+ R+A+M DP++ GR++E GT P GL +ARM H+TYLSD + KFGR ++ Sbjct: 186 FNEVARRAIMTDPEFNGGRFIEAGTTPKGGLALARMLGHLTYLSDDMMGAKFGRELRSES 245 Query: 264 LPTFSFDADFQVESYLRHQGSSFV--ERFDANSYLYLTRAMDYFDIAADHNGVLAAAFRD 321 L +SFD +FQVESYLR+QG F + FDAN+YL +T+A+DYFD AA+ + L+AAF Sbjct: 246 L-KYSFDVEFQVESYLRYQGEKFATKQNFDANTYLLMTKALDYFDPAAEFDNNLSAAFAQ 304 Query: 322 TRTRFCVVSFTSDWLFPTSESRATVHALNAGGARVSFAEIETDRGHDAFLLDLPEFFDIA 381 T+ F VVSFTSDW F + SR V AL VS+AEIE++ GHDAFLL + I Sbjct: 305 TQASFLVVSFTSDWRFSPTRSREIVRALLDNDRAVSYAEIESEHGHDAFLLPNTHYEGIF 364 Query: 382 HAFL 385 A++ Sbjct: 365 RAYM 368 Lambda K H 0.323 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 377 Length adjustment: 30 Effective length of query: 369 Effective length of database: 347 Effective search space: 128043 Effective search space used: 128043 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_013834891.1 THICY_RS01725 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.16397.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-142 461.1 0.0 1.4e-142 460.9 0.0 1.0 1 lcl|NCBI__GCF_000214825.1:WP_013834891.1 THICY_RS01725 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000214825.1:WP_013834891.1 THICY_RS01725 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 460.9 0.0 1.4e-142 1.4e-142 3 350 .. 16 368 .. 14 369 .. 0.97 Alignments for each domain: == domain 1 score: 460.9 bits; conditional E-value: 1.4e-142 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 +l+l sG++l++++++y+tyG+lna+ +Navl+cHal+g++hv+g+++ ++k GWW++++Gpg+++dt lcl|NCBI__GCF_000214825.1:WP_013834891.1 16 MPLQLVSGAELPSYDLVYETYGELNADASNAVLICHALSGDHHVTGYYEGDTKpGWWSDYIGPGKPVDT 84 5899*********************************************99889*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +++fvvc+N+lG+c+Gs+gP+s+np+tgk yg++fP vt rD+v+ q++l ++Lg+e++aav+GgS+GG lcl|NCBI__GCF_000214825.1:WP_013834891.1 85 NEFFVVCSNNLGGCRGSSGPASLNPATGKVYGPDFPIVTCRDWVNSQNTLRQHLGIEQWAAVIGGSMGG 153 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+++wa++ p+++++++v+a+++++saq+iafnev+r+ai++Dpe+n+G++ e + +P+ GLalARml lcl|NCBI__GCF_000214825.1:WP_013834891.1 154 MQVMQWAIDHPDKLRHALVIAAAPKLSAQNIAFNEVARRAIMTDPEFNGGRFIEAGtTPKGGLALARML 222 ******************************************************999************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfver..FdAnsYllltkaldthdl 274 ++ltY+s++ + ++fgre +se sl++s++ ef+vesylryqg+kf+++ FdAn+Yll+tkald++d lcl|NCBI__GCF_000214825.1:WP_013834891.1 223 GHLTYLSDDMMGAKFGRELRSE-SLKYSFDVEFQVESYLRYQGEKFATKqnFDANTYLLMTKALDYFDP 290 ******************9998.88999******************96444****************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekek 341 a++ +++l++a+++++a++lvv+++sD++f++++++e+++al +++ + yaeiese+GHDaFll +++ lcl|NCBI__GCF_000214825.1:WP_013834891.1 291 AAEFDNNLSAAFAQTQASFLVVSFTSDWRFSPTRSREIVRALLDNDRAvsYAEIESEHGHDAFLLPNTH 359 *****************************************999887778******************9 PP TIGR01392 342 veelirefl 350 +e + r+++ lcl|NCBI__GCF_000214825.1:WP_013834891.1 360 YEGIFRAYM 368 999888876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.08 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory