Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate WP_013835367.1 THICY_RS04220 histidinol-phosphate transaminase
Query= reanno::Phaeo:GFF2492 (361 letters) >NCBI__GCF_000214825.1:WP_013835367.1 Length = 363 Score = 232 bits (591), Expect = 1e-65 Identities = 134/335 (40%), Positives = 194/335 (57%), Gaps = 4/335 (1%) Query: 25 GMSNVTKLSSNENPLGPSPKAIEAMQAAVSEMHRYPSSDHSGLRQAIGEVYGLPMEQIIC 84 G+S VTKL+SNENPLG S K +A + A+ + RYP + LR AI E M +++ Sbjct: 31 GLSRVTKLASNENPLGVSAKVEQAAKLALKTLGRYPDGNAFYLRAAIAEFTCRTMPEVMV 90 Query: 85 GAGSDEIITFLCQAYAGPGDEVLFTEHGFAMYRISALAAGATPVEVAERDRVTDVDALLA 144 G GS+E++ F+ + +AGPGDEV+F+++ FA+Y I+A GATP++V + D+DA+ A Sbjct: 91 GNGSNELLEFVGRVFAGPGDEVIFSQYAFAVYAITAQIIGATPIQVTAKAYGHDLDAMAA 150 Query: 145 GCTERTRLVFIANPNNPTGTMIGMADLARLADGLPKGALLVLDGAYAEYVEGYDA--GAA 202 T +T+L+++ANPNNPTG+ L +P ++V D AY EYVE DA G A Sbjct: 151 AITSKTKLIYLANPNNPTGSFFSADALTAFMQKVPANVVVVYDEAYLEYVERDDAPSGLA 210 Query: 203 LVANRDNVVMTRTFSKIYGLGGARVGWGYAPKPIIDVLNRVRGPFNLSSTALAGAEAAVR 262 L+ NV++TRTFSK YGL RVG+ A I+++LNR+R PFN++ + A AA+ Sbjct: 211 LLDQYPNVIVTRTFSKAYGLAALRVGYLLAHPDIVNLLNRIRAPFNVNELSQVCAVAALA 270 Query: 263 DTDYTEHCRKENAKWRTWLAEALAELGVPSDTSCANFILARFASPEEAGACDAFLQSRGL 322 D D+ N + R+ + AL +G S NF+ PE A LQ G+ Sbjct: 271 DQDFVAASVALNKQERSKVITALTHMGYTPLPSEGNFVCVNM-GPEAASINQQLLQ-LGV 328 Query: 323 IVRRVTGYKLPAALRITVGDETACNALVAAMKVFK 357 IVR V Y + LRI++G E L+ A+ K Sbjct: 329 IVRPVANYGMADFLRISIGTEAENQHLITALAQVK 363 Lambda K H 0.318 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 363 Length adjustment: 29 Effective length of query: 332 Effective length of database: 334 Effective search space: 110888 Effective search space used: 110888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013835367.1 THICY_RS04220 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.24522.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-109 351.4 0.1 2.7e-109 351.2 0.1 1.0 1 lcl|NCBI__GCF_000214825.1:WP_013835367.1 THICY_RS04220 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000214825.1:WP_013835367.1 THICY_RS04220 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 351.2 0.1 2.7e-109 2.7e-109 2 348 .. 9 361 .. 8 362 .. 0.98 Alignments for each domain: == domain 1 score: 351.2 bits; conditional E-value: 2.7e-109 TIGR01141 2 ekikklepYqpg......arelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkeal 64 ++i k++pY pg +relg + v kL+snEnP+g+s kv +a+k +lk+l rYpd +a+ l++a+ lcl|NCBI__GCF_000214825.1:WP_013835367.1 9 PHIAKISPYIPGkpvselQRELGLSRVTKLASNENPLGVSAKVEQAAKLALKTLGRYPDGNAFYLRAAI 77 5799***************************************************************** PP TIGR01141 65 akylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedl 133 a+++ ++ ++++gnGs+el+e++ r f+ pgd+v+++++++++Y+++a+i ga ++v +k+ g +dl lcl|NCBI__GCF_000214825.1:WP_013835367.1 78 AEFTCRTMPEVMVGNGSNELLEFVGRVFAGPGDEVIFSQYAFAVYAITAQIIGATPIQVTAKAYG-HDL 145 ***************************************************************96.9** PP TIGR01141 134 eavleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellae 198 +a+++a+++k+kl++la+PnnPtG++++++ +++++++v ++++VV DeAY e+ e+ +s l ll + lcl|NCBI__GCF_000214825.1:WP_013835367.1 146 DAMAAAITSKTKLIYLANPNNPTGSFFSADALTAFMQKVpANVVVVYDEAYLEYVERddaPSGLALLDQ 214 ***************************************88***************99999******** PP TIGR01141 199 ypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevk 267 ypn++v+rT+SKa+gLA+lRvGy++a+++i++ l+++rap+nv++l++ +avaal d+d+++++v+ +k lcl|NCBI__GCF_000214825.1:WP_013835367.1 215 YPNVIVTRTFSKAYGLAALRVGYLLAHPDIVNLLNRIRAPFNVNELSQVCAVAALADQDFVAASVALNK 283 ********************************************************************* PP TIGR01141 268 kererlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtr 336 +er ++++l+++ g +S++NFv +++ +a+ + ++ll+ g+ivR ++++ g+ ++lRi++Gt+ lcl|NCBI__GCF_000214825.1:WP_013835367.1 284 QERSKVITALTHM-GYTPLPSEGNFVCVNMGPEAASINQQLLQLGVIVRPVANY-GM-ADFLRISIGTE 349 ***********99.899*************99**********************.86.*********** PP TIGR01141 337 eenerllealke 348 en++l++al++ lcl|NCBI__GCF_000214825.1:WP_013835367.1 350 AENQHLITALAQ 361 *********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.44 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory