Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_013835368.1 THICY_RS04225 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000214825.1:WP_013835368.1 Length = 364 Score = 323 bits (828), Expect = 4e-93 Identities = 175/364 (48%), Positives = 238/364 (65%), Gaps = 3/364 (0%) Query: 2 SEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVL 61 +EA+QL+ +R +ID++DE I LI++RA CA +VA +KT EAVFYRPEREA VL Sbjct: 3 TEAEQLQQIRQQIDAIDEHIQALITQRALCANQVADIKTQGG--RVEAVFYRPEREAQVL 60 Query: 62 KHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVIS 121 + + N L +++MARLFREIMS CLALEQPLRVAYLGPEG+++ AA LK FG Sbjct: 61 RAVKARNTSVLSDDDMARLFREIMSVCLALEQPLRVAYLGPEGSYTHAAVLKQFGSFAQP 120 Query: 122 KPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLL 181 P++ I++VF+ V V++GVVP+ENSTEGAV T D + + GEVEL IHH LL Sbjct: 121 VPVSTIEDVFKVVDTQQVDYGVVPLENSTEGAVTTTQDCLICTQATVTGEVELPIHHCLL 180 Query: 182 VGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAG 241 G++ IT++ +H Q+L QCR WL + P V+ AV SNA AA+ + + + AAIA Sbjct: 181 -GQSKNLQGITKVLAHPQALGQCRTWLRNNLPGVKLEAVDSNALAAQMAQEQADVAAIAS 239 Query: 242 DMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLM 301 + AA LY L L IED N+T+F +IG P+G+DKT++I+S+ N+ GAL +L Sbjct: 240 EQAASLYQLHILKSHIEDAQNNTTKFWVIGRHAPTPSGEDKTAMILSLANEAGALLRILE 299 Query: 302 PFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 F I +TRI +RP+ KW Y+F+ID GH QDP + L ++ A K+LGSYP Sbjct: 300 SFAKRNISMTRIVSRPASDQKWDYMFYIDITGHQQDPAVAEALAEVQANARFFKLLGSYP 359 Query: 362 KAVL 365 + L Sbjct: 360 VSPL 363 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 364 Length adjustment: 29 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013835368.1 THICY_RS04225 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.28809.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-28 85.4 0.7 2.8e-28 84.3 0.7 1.6 1 lcl|NCBI__GCF_000214825.1:WP_013835368.1 THICY_RS04225 prephenate dehydra Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000214825.1:WP_013835368.1 THICY_RS04225 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.3 0.7 2.8e-28 2.8e-28 1 76 [] 8 84 .. 8 84 .. 0.97 Alignments for each domain: == domain 1 score: 84.3 bits; conditional E-value: 2.8e-28 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkks.aseaviYRPeREaavlrrlkelnkGpLdqeavar 70 L+++R++iDaiD++i L+++Ra +a++v+++K+++ eav+YRPeREa+vlr +k +n+ L ++++ar lcl|NCBI__GCF_000214825.1:WP_013835368.1 8 LQQIRQQIDAIDEHIQALITQRALCANQVADIKTQGgRVEAVFYRPEREAQVLRAVKARNTSVLSDDDMAR 78 7899******************************99678******************************** PP TIGR01807 71 ifrEim 76 +frEim lcl|NCBI__GCF_000214825.1:WP_013835368.1 79 LFREIM 84 *****9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory