Align Homocysteine formation from aspartate semialdehyde (DUF39 component) (characterized)
to candidate WP_013840252.1 DESRU_RS00885 hypothetical protein
Query= reanno::Miya:8500721 (390 letters) >NCBI__GCF_000215085.1:WP_013840252.1 Length = 399 Score = 434 bits (1117), Expect = e-126 Identities = 217/384 (56%), Positives = 271/384 (70%), Gaps = 2/384 (0%) Query: 6 VNKTIAEINERIRQGKAVVLNAEEMTEAVRRMGKEKAAREIDVVTTGTFSPMCSSGLLFN 65 V +T AEIN RIR GKAVVL AEE+ VR G K A E+DVVTTGTF PMCSSG N Sbjct: 3 VERTYAEINARIRAGKAVVLTAEEVIGKVREQGLAKTAAEVDVVTTGTFGPMCSSGAFLN 62 Query: 66 IGQQDPPTLKTAKVWMNDVPAYAGLAAVDSYLGATEPTEDDPLNKVYPGRFKYGGGHVIE 125 G P ++ KV +N+VPAY G+AAVD+Y+G TE EDDP N +PG F+YGGGHVIE Sbjct: 63 FGHSSP-RMRMQKVSLNNVPAYTGIAAVDAYIGVTEIPEDDPANNNFPGEFRYGGGHVIE 121 Query: 126 DLVRGKAVHLRAEAYGTDCYPRKSLDKKITLSELPYAHLLNPRNCYQNYNAAVNLTSRII 185 DLV K V L+A +YGTDCYPRK ++ ITL ++ A L NPRN YQNYN AVNL+ + I Sbjct: 122 DLVSHKPVKLKALSYGTDCYPRKEIETTITLDDMNEAILFNPRNAYQNYNCAVNLSEKTI 181 Query: 186 YTYMGPLKPNLRNVNFATAGRISPLFNDPLFRTIGLGTRIFLGGGTGYVLGAGTQHVAA- 244 YTYMG LKP L N ++T+G++SPL DP F TIG+GTRIFLGGG GYV+ GTQH Sbjct: 182 YTYMGTLKPRLGNATYSTSGQLSPLMKDPNFATIGIGTRIFLGGGIGYVVWNGTQHFPGW 241 Query: 245 PKRTERGLPLSPAGTLMLKGDLKGMNARYLRGLSFLGYGCSLAVGVGIPIPILNEEIAWF 304 K E + S GTL + GDLK M ++LRG S+ GYG +L VG+GIPIPILNEEI F Sbjct: 242 LKDAEGNIVGSAGGTLSVLGDLKQMKPQWLRGTSYQGYGATLTVGLGIPIPILNEEILRF 301 Query: 305 TGVDDSDIQMPVKDYGHDYPNCLPRVIQHVTYEDLKSGEVEIMGKKVETVPMTSYPLSLE 364 + D ++ PV DY +YPN + + V+Y LKSG++ + G+++ TVP++SYP + E Sbjct: 302 AALSDEELHAPVVDYSDNYPNRVGGNLGLVSYAQLKSGKITVQGQEIPTVPLSSYPKARE 361 Query: 365 VANTLKSWIEKGEFLLTEPVELLP 388 +A TLK WI+KG+FLL EPV+LLP Sbjct: 362 IARTLKEWIQKGDFLLGEPVQLLP 385 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 399 Length adjustment: 31 Effective length of query: 359 Effective length of database: 368 Effective search space: 132112 Effective search space used: 132112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory