Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_013840424.1 DESRU_RS01835 ornithine carbamoyltransferase
Query= BRENDA::O93656 (317 letters) >NCBI__GCF_000215085.1:WP_013840424.1 Length = 313 Score = 393 bits (1009), Expect = e-114 Identities = 190/306 (62%), Positives = 243/306 (79%) Query: 5 LKGRDLLCLQDYTPEEIWTILETAKMLKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSF 64 LKG+D L L D++ EE+ +L+ A +K QK G PH L GKTLAMIFQK STRTRVSF Sbjct: 8 LKGKDFLTLHDFSVEEVQFMLDEAVRIKGLQKSGIPHPYLRGKTLAMIFQKSSTRTRVSF 67 Query: 65 EVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYASV 124 EVAM LGG+AL+L+ +D+Q+ RGE+IADTARVLSR+VD IM R Y VE+LA YA+V Sbjct: 68 EVAMVQLGGYALFLSPKDIQMGRGESIADTARVLSRFVDGIMIRTYAQSQVEELAHYATV 127 Query: 125 PVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVV 184 PVINGL+D +HPCQ LAD++TI E KG + G+++ YVGDGNN+AHSLM K+G ++ + Sbjct: 128 PVINGLTDLTHPCQILADFLTIKEHKGRLAGLRLAYVGDGNNIAHSLMYGCAKVGMNISI 187 Query: 185 ATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEER 244 A+PEGY+PD+KV++ A+Q+A +G E++ DPV+AV ADV+ TDVW SMGQEAE + R Sbjct: 188 ASPEGYKPDQKVVELAKQDALATGARIEIVTDPVQAVTGADVVVTDVWTSMGQEAEYDLR 247 Query: 245 RKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDEAENRLHAQKA 304 +KIF P+Q+NK+L AK DY+ +HCLPAHRGEEVTD++ID P+S VWDEAENRLHAQKA Sbjct: 248 KKIFAPYQLNKELCALAKEDYISLHCLPAHRGEEVTDEIIDGPHSAVWDEAENRLHAQKA 307 Query: 305 VLALLL 310 VLALL+ Sbjct: 308 VLALLM 313 Lambda K H 0.319 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 313 Length adjustment: 27 Effective length of query: 290 Effective length of database: 286 Effective search space: 82940 Effective search space used: 82940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_013840424.1 DESRU_RS01835 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.1951.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-137 443.5 0.0 2e-137 443.3 0.0 1.0 1 lcl|NCBI__GCF_000215085.1:WP_013840424.1 DESRU_RS01835 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000215085.1:WP_013840424.1 DESRU_RS01835 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 443.3 0.0 2e-137 2e-137 1 303 [. 11 313 .] 11 313 .] 0.99 Alignments for each domain: == domain 1 score: 443.3 bits; conditional E-value: 2e-137 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 +++l+l+d+s ee++ +l+ a ++k +k+g + +l+gktla+iF+k+stRtRvsfeva+++lG+ +l lcl|NCBI__GCF_000215085.1:WP_013840424.1 11 KDFLTLHDFSVEEVQFMLDEAVRIKGLQKSGIPHPYLRGKTLAMIFQKSSTRTRVSFEVAMVQLGGYAL 79 79******************************************************************* PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 +l+++++q+gr+esi+Dtarvlsr+vd+i++R+y++++veela+ya+vPvingLtdl+hPcqilaD+lt lcl|NCBI__GCF_000215085.1:WP_013840424.1 80 FLSPKDIQMGRGESIADTARVLSRFVDGIMIRTYAQSQVEELAHYATVPVINGLTDLTHPCQILADFLT 148 ********************************************************************* PP TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207 ike++g+l +++l+yvGD+nn+a+sl+ ++ak+G+++++a+Peg++p++++v+ ak+ a ++g+++e++ lcl|NCBI__GCF_000215085.1:WP_013840424.1 149 IKEHKGRLAGLRLAYVGDGNNIAHSLMYGCAKVGMNISIASPEGYKPDQKVVELAKQDALATGARIEIV 217 ********************************************************************* PP TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276 dp++av++adv++tDvw+smG+e++ + r k++ pyq+n+el +lak++++ lhCLPa+rGeevtde+ lcl|NCBI__GCF_000215085.1:WP_013840424.1 218 TDPVQAVTGADVVVTDVWTSMGQEAEYDLRKKIFAPYQLNKELCALAKEDYISLHCLPAHRGEEVTDEI 286 ********************************************************************* PP TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303 ++g++s v+deaenRlhaqkavl++l+ lcl|NCBI__GCF_000215085.1:WP_013840424.1 287 IDGPHSAVWDEAENRLHAQKAVLALLM 313 ***********************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory