Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_013840649.1 DESRU_RS02985 aspartate aminotransferase family protein
Query= curated2:Q7VAS9 (419 letters) >NCBI__GCF_000215085.1:WP_013840649.1 Length = 462 Score = 195 bits (496), Expect = 2e-54 Identities = 139/432 (32%), Positives = 233/432 (53%), Gaps = 54/432 (12%) Query: 33 PLKIVKGNGCWLWDETGKKYLDAVAGIATC-SLGHSDKKLSKVLSQQLRKIQHVS----N 87 P +V+G GC + D G++YLDAV+G C ++G+ +++ + +QL+K+ + + N Sbjct: 36 PTIMVEGKGCLVKDIRGREYLDAVSGGVWCVNVGYGQDSIAEAVCEQLKKLPYYAMSAGN 95 Query: 88 LYRIPEQEDLAQWLVNQSCADSVFFCNSGAEANEAAIKLARKYGQIKRGIKRPI-ILSAK 146 + I + + L N VFF NSG+EANE A K++R+Y ++K K IL + Sbjct: 96 IPAILLSQKINALLPN---LQRVFFSNSGSEANEKAFKMSRQYFRLKYPQKDKYKILFRQ 152 Query: 147 SSFHGRTLAALSATGQTKYQKGFEPLVEGF------------------EFFSFNDSNSVQ 188 +HG T+AALSATGQ + + G+EPLV GF + + ++ Sbjct: 153 RDYHGTTVAALSATGQPERKLGYEPLVPGFIGDLPPAYCYRCSFGKTYPHCNIECARVLE 212 Query: 189 DLYENLEKDEPRVAAILIEPIQGEGGLNLGDQKFFYFLRDYCNKNNILLLFDEVQSGMGR 248 D+ ++ +D VAA+++EPI GG+ + ++ +++ C K +LL+ DEV +G GR Sbjct: 213 DIIQSEREDT--VAALILEPITAGGGVIVPADEYLSIIQEICRKYEVLLILDEVVNGFGR 270 Query: 249 TGKLWGYEHFNVEPDAFTLAKGLGGGH-SIGALLVKE---NASIFEPGD------HASTF 298 TGK +G++H++V+PD T+AKG+ + + A +VKE + +P D ST+ Sbjct: 271 TGKWFGHQHWDVDPDMVTMAKGMASSYMPLSATVVKEYVFEQFLGDPSDKLGYFRDISTY 330 Query: 299 GGNPFACKAGLTVAKEIQNRNLLENTYCRGNQLREGLQKLINNYPHHLEEVRGIGLMLGL 358 GG AC AGL + I+ +NL +N+ G L +GL++L ++P + +VRG GL G+ Sbjct: 331 GGCAAACTAGLESTRIIEEQNLCQNSAEMGKYLLDGLKEL-ESFP-VVGQVRGKGLFAGI 388 Query: 359 AI---KKNSNLTSQ----KIVELAIKEGLLVIGAG------EKVIRMLPPLIITKREIET 405 + KK S+ K++ A +G+L+ VI M P LI+TK EI+ Sbjct: 389 ELVEDKKTKVPVSEQFLGKVLAEAAAQGVLLGKTNRSNPGYNNVIAMAPALIVTKDEIDR 448 Query: 406 LLTRLNACFRKL 417 ++ + K+ Sbjct: 449 IVAAIKKALEKV 460 Lambda K H 0.319 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 462 Length adjustment: 32 Effective length of query: 387 Effective length of database: 430 Effective search space: 166410 Effective search space used: 166410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory