Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_013841352.1 DESRU_RS06675 homocitrate synthase
Query= curated2:O26819 (496 letters) >NCBI__GCF_000215085.1:WP_013841352.1 Length = 377 Score = 321 bits (823), Expect = 2e-92 Identities = 170/370 (45%), Positives = 245/370 (66%), Gaps = 2/370 (0%) Query: 2 QVRVLDTTLRDGEQTPGVSLTPEEKLRIALKIDALGADIIEAGSAITSEGEREGIRKITS 61 ++ ++DTTLRDGEQT GV EK+RIA +D +G D IEAG + E+E I++I Sbjct: 5 KIWIVDTTLRDGEQTAGVVFANREKVRIASFLDEMGVDQIEAGVPVMGGDEQEAIKQICQ 64 Query: 62 EGLRAEICSFARAVREDIDAAISCDVDSVHLVVPTSDLHLEHKLRKTREEVLEQAVDCTE 121 GL+A + + R V +DI+A++ C VD+V + + TSD+H++HKL+ +RE V+E V TE Sbjct: 65 LGLKASVMGWNRPVLKDIEASLKCGVDAVAISISTSDIHIKHKLKTSREWVVEHMVRATE 124 Query: 122 YAVDHGILVELSAEDSTRSDMDFLRTIFREGIEAGAERICACDTVGILTPERSYEFYRGL 181 +A G+ + ++AED++RSDM+FL + +AGA+R+ CDTVGIL P +YE + L Sbjct: 125 FAKKEGMYISVNAEDASRSDMNFLIEFAKAAKQAGADRLRYCDTVGILEPFTTYERIKAL 184 Query: 182 SE-LGAPLSVHCHNDFGLAVANSLAGLRAGASEVHATINGIGERAGNAALEEVVVALKSL 240 E + + +H HNDFG+A AN+LAG+RAGA+ V TI G+GERAGN+ LEEVV+ALK L Sbjct: 185 KEAVDLEVEMHTHNDFGMATANALAGVRAGANWVGVTIMGLGERAGNSPLEEVVMALKHL 244 Query: 241 YDVDTSINIEMLYETSRMVARMTGVYLQPNKAIVGENAFAHESGIHADGVLKKAETYEPI 300 YD+D S E+ E + V+R +G L +KAIVG N FAHESGIHADG +K +TYE Sbjct: 245 YDIDLSFKTEIFREVAEYVSRASGRELHCSKAIVGSNMFAHESGIHADGAIKNPKTYEAF 304 Query: 301 TPEMVGHGRGFVMGKHIGTHALRKRLDELGMKVADDKLMEIFRRVKTLG-DMGKCVTDVD 359 PE VG R V+GKH GT +LR + E G+ +A ++ E+ ++++ + + + D + Sbjct: 305 QPEEVGLERQIVIGKHSGTASLRMKFAEYGIDLAKEEAEELLPKIRSAAVSLKRSLFDKE 364 Query: 360 LQAIAEDVLG 369 L I ED G Sbjct: 365 LVYIYEDHFG 374 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 496 Length of database: 377 Length adjustment: 32 Effective length of query: 464 Effective length of database: 345 Effective search space: 160080 Effective search space used: 160080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory