Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_013841857.1 DESRU_RS09305 homoserine O-succinyltransferase
Query= SwissProt::A5N8M0 (309 letters) >NCBI__GCF_000215085.1:WP_013841857.1 Length = 305 Score = 458 bits (1179), Expect = e-134 Identities = 212/304 (69%), Positives = 256/304 (84%) Query: 1 MPIKIKDDLPAAEILNSENIFIMPENVAFHQDIRPLKIAILNLMPIKITTEVQLLRLIGN 60 MPIKI D LPA++IL +ENIF+M E A QDIRPLK+AILNLMP KITTE QLLRL+GN Sbjct: 1 MPIKIPDHLPASQILTNENIFVMHETRAVRQDIRPLKMAILNLMPTKITTETQLLRLLGN 60 Query: 61 TALQIEIELLHLKTHVCKNTSEEYLTNFYRTFDEIKNEKFDGLIITGAPIEQLEFSRVNY 120 T LQ+E+ELLH +H KNT E++L FY+TF+E+KN+KFDGLIITGAP+EQLEF++V+Y Sbjct: 61 TPLQVEVELLHTGSHWSKNTPEDHLAVFYKTFEEVKNQKFDGLIITGAPVEQLEFNQVDY 120 Query: 121 WEELKDIMEWSKCHVYSTLHICWGAQAGLYYHYGIPKYILKEKLFGVFKHEVTEEKEKLV 180 WEEL++IMEWSK HV STLHICW AQAGLYYHYGIPKY L KLFGVFKH + KL+ Sbjct: 121 WEELQEIMEWSKDHVTSTLHICWAAQAGLYYHYGIPKYDLPAKLFGVFKHWINRSHIKLL 180 Query: 181 RGFDDEFYVPHSRYTEVKREDVEKVKELTILAQSKKAGVYLILDNKGRRIFVTGHSEYDP 240 RGFDDEFYVPHSRYTEV+R D+E+V+EL IL++S +AGVY++ R F+TGHSEYDP Sbjct: 181 RGFDDEFYVPHSRYTEVRRRDIERVEELEILSESDEAGVYIVAAKNRRMFFITGHSEYDP 240 Query: 241 LTLKDEYMRDISKGEDIKMPENYFPDDNPDRKPVVKWRSHADLLFSNWLNYYVYQETPYD 300 LTLK EY RD+ KG DI +P+NY+P+DNP+ +PVVKWR HA LLFSNWLNYYVYQETP++ Sbjct: 241 LTLKGEYERDVKKGLDILVPQNYYPEDNPENEPVVKWRGHAHLLFSNWLNYYVYQETPFN 300 Query: 301 LSEM 304 L+E+ Sbjct: 301 LTEI 304 Lambda K H 0.320 0.139 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 305 Length adjustment: 27 Effective length of query: 282 Effective length of database: 278 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory