Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_013843546.1 DESRU_RS18130 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000215085.1:WP_013843546.1 Length = 393 Score = 471 bits (1212), Expect = e-137 Identities = 237/397 (59%), Positives = 308/397 (77%), Gaps = 4/397 (1%) Query: 1 MEKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHL 60 M+K +++D+D+K KRV +RVDFNVP++ + DDTRI+ ALPTI+Y + QGAKVIL SHL Sbjct: 1 MQKKSVKDIDVKSKRVFVRVDFNVPLEGERITDDTRIQKALPTIEYLINQGAKVILASHL 60 Query: 61 GRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFH 120 GRPKGE ++ L PVA RLS LLGKEV V VG +V++A+E +++G+VLLLEN RFH Sbjct: 61 GRPKGEVVEKYRLTPVAGRLSGLLGKEVIKVNDSVGPQVQQAIEGMRDGDVLLLENVRFH 120 Query: 121 PGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSK 180 ETKND + A+ A LADI+VNDAFG AHRAHAS GIA+++P+VAGFLMEKE++ L K Sbjct: 121 AEETKNDEKYARQLAELADIYVNDAFGAAHRAHASTAGIAEYLPAVAGFLMEKELEMLGK 180 Query: 181 VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE 240 +PE+P+V ++GGAKVSDKIGVI NL+ K D ++IGG M TFLKA G G S +E+ Sbjct: 181 AVTHPERPFVAIIGGAKVSDKIGVIENLLSKVDALIIGGGMANTFLKAQGYATGKSLLEQ 240 Query: 241 DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET 300 DK+DLAK+L+E+A+ +GVE++LP DAV+A +EP ++KVV + + IP WM LDIGPET Sbjct: 241 DKVDLAKDLIERARTRGVELLLPTDAVVALAMEPAAQQKVVPVSE-IPGDWMVLDIGPET 299 Query: 301 IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV 360 F + A TVVWNGPMGVFE++ FA+GT+ +A A+AA KG T+VGGGDS AAV Sbjct: 300 ARRFTAAIEKAATVVWNGPMGVFEMEPFAKGTEALAHALAA--SKGT-TIVGGGDSVAAV 356 Query: 361 NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADK 397 NK G+ +K SH+STGGGASLEFLEGKELPG+A++ +K Sbjct: 357 NKTGVAEKISHISTGGGASLEFLEGKELPGVAALQNK 393 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 702 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 393 Length adjustment: 34 Effective length of query: 620 Effective length of database: 359 Effective search space: 222580 Effective search space used: 222580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory