Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_014026153.1 PYRFU_RS02980 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000223395.1:WP_014026153.1 Length = 393 Score = 291 bits (744), Expect = 3e-83 Identities = 172/359 (47%), Positives = 223/359 (62%), Gaps = 16/359 (4%) Query: 2 AGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRRE 61 AG++ G LFRVTTFGESHG ALG +VDGVP G+PL+E D+ +L RRPG R+ T RRE Sbjct: 3 AGSSFGLLFRVTTFGESHGSALGVVVDGVPAGMPLSERDVYKELLLRRPG-HRWATARRE 61 Query: 62 PDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLR--D 119 PD+ +ILSGVFEG TTG I +++ N D S+ Y ++ RPGHAD Y KYG D Sbjct: 62 PDKPEILSGVFEGRTTGHPIAIVVWNRDVDSRPYEEVRCKPRPGHADLAYVLKYGWENWD 121 Query: 120 YRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPL-------DIKDWSQ 172 YRGGGR+S RET RVAAGA+AKK L G+ + G L ++G + L ++++ Sbjct: 122 YRGGGRASGRETVGRVAAGAVAKKLLLAA-GLTVYGRLAEIGGLELVDPRAEPSVEEFLA 180 Query: 173 VEQNPFFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAH 232 +P D + ++ + EGDS+G V VVA GVP GLG+PVFD+L AD+A Sbjct: 181 ARHSPVRVHDRRLEQEVMRVIEEARAEGDSLGGVVEVVAFGVPPGLGDPVFDKLKADLAK 240 Query: 233 ALMSINAVKGVEIGDGFDVVALRGSQNRDEITKDGFQSNHA----GGILGGISSGQQIIA 288 ALMSI G E+G GF + ++GS+ RD I Q GG+LGG+S G I Sbjct: 241 ALMSIPGAVGFEVGLGFRLARMKGSEARDPIRLVNGQPRPVGPAHGGMLGGLSVGTPIRL 300 Query: 289 HMALKPTSSITVPGRTINRFGEEVEMIT-KGRHDPCVGIRAVPIAEAMLAIVLMDHLLR 346 +A KPTSSI P T N + I+ KGRHDP + +RAV +AEAM+AI L DH+LR Sbjct: 301 RIAFKPTSSIPRPIETWNLCENRPDTISVKGRHDPALVVRAVAVAEAMVAITLADHMLR 359 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 24 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 393 Length adjustment: 30 Effective length of query: 331 Effective length of database: 363 Effective search space: 120153 Effective search space used: 120153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_014026153.1 PYRFU_RS02980 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.5692.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-122 393.4 0.0 5.1e-122 393.1 0.0 1.0 1 lcl|NCBI__GCF_000223395.1:WP_014026153.1 PYRFU_RS02980 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014026153.1 PYRFU_RS02980 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.1 0.0 5.1e-122 5.1e-122 1 347 [. 11 360 .. 11 363 .. 0.96 Alignments for each domain: == domain 1 score: 393.1 bits; conditional E-value: 5.1e-122 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r+ttfGeSHg alg+++dG+Pag++l+e d+ kel Rrpg+ r ++ r+E D+ eilsGvfeG+TtG lcl|NCBI__GCF_000223395.1:WP_014026153.1 11 FRVTTFGESHGSALGVVVDGVPAGMPLSERDVYKELLLRRPGH-RWATARREPDKPEILSGVFEGRTTG 78 89****************************************9.************************* PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikd..regggrsSaReTaarvaaGavakklL 136 Pia+++ N+dv+s++ye+++ +pRPgHad++y+ KYg ++ ++gggr+S+ReT++rvaaGavakklL lcl|NCBI__GCF_000223395.1:WP_014026153.1 79 HPIAIVVWNRDVDSRPYEEVRCKPRPGHADLAYVLKYGWENwdYRGGGRASGRETVGRVAAGAVAKKLL 147 **************************************98777************************** PP TIGR00033 137 ketagieivayvvklgeveleeesakeiskerldk..spvrcpdaeaekemeeeidkakkdgdsvGgvv 203 ag+ + + + ++g +el + a+ +e l++ spvr+ d++ e+e+ +i++a+ +gds+Ggvv lcl|NCBI__GCF_000223395.1:WP_014026153.1 148 LA-AGLTVYGRLAEIGGLELVDPRAEPSVEEFLAArhSPVRVHDRRLEQEVMRVIEEARAEGDSLGGVV 215 99.89************999988888444554444459******************************* PP TIGR00033 204 evvvsnvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnn 272 evv+ +vp glG+p+fdkl+a la+al+si+ + g+e+G GF++a+++Gsea D++ l +++ r + lcl|NCBI__GCF_000223395.1:WP_014026153.1 216 EVVAFGVPPGLGDPVFDKLKADLAKALMSIPGAVGFEVGLGFRLARMKGSEARDPIRLVNGQPRPVGPA 284 ********************************************************************* PP TIGR00033 273 sGGieGGitnGedirvriavKpiptikkplktvdletkekakat.kgRhDpcvvpravpvvEamvalvl 340 GG++GG++ G++ir+ria+Kp+++i +p +t +l ++ + +++ kgRhDp+ v+rav v+Eamva++l lcl|NCBI__GCF_000223395.1:WP_014026153.1 285 HGGMLGGLSVGTPIRLRIAFKPTSSIPRPIETWNLCENRPDTISvKGRHDPALVVRAVAVAEAMVAITL 353 ***********************************9999999999************************ PP TIGR00033 341 adallek 347 ad++l++ lcl|NCBI__GCF_000223395.1:WP_014026153.1 354 ADHMLRN 360 ****987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.25 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory