Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate WP_014026421.1 PYRFU_RS04350 aspartate-semialdehyde dehydrogenase
Query= SwissProt::Q57658 (354 letters) >NCBI__GCF_000223395.1:WP_014026421.1 Length = 352 Score = 331 bits (848), Expect = 2e-95 Identities = 171/346 (49%), Positives = 228/346 (65%), Gaps = 1/346 (0%) Query: 8 KIKVGVLGATGSVGQRFVQLLADHPMFELTALAASERSAGKKYKDACYWFQDRDIPENIK 67 K++ VLGATG VGQ FV+LL +HPMFE+ +AASERSAG+ Y +A W PE++ Sbjct: 4 KLRAAVLGATGLVGQMFVKLLDEHPMFEIVYVAASERSAGRSYCEAVNWVLGGSPPESLC 63 Query: 68 DMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVI 127 + V + +VD+VFSALPS +A + E A+ G + SNAS R+EEDVPL++ Sbjct: 64 GIKVEKVGVDNVPKSEVDVVFSALPSSVAGEIEAGLARRGFTVVSNASPMRLEEDVPLLV 123 Query: 128 PEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVS 187 PE+N DH+ L++IQR++RGW GAI NPNCS+ V++LKP++D FGLE V + TMQAVS Sbjct: 124 PEINWDHVGLVKIQRQRRGWSGAIYKNPNCSSAILVLSLKPLLDNFGLEKVLVTTMQAVS 183 Query: 188 GAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFKISASCNRVAVI 247 GAGYNGVPSMAILDN++PFI EEEK+ E K+LG + +VE A F I A+ RV V+ Sbjct: 184 GAGYNGVPSMAILDNIVPFIAKEEEKLANEPRKILGVYRGDRVEWARFTIHATTTRVPVL 243 Query: 248 DGHTESIFVKTKEGAEPEEIKEVMDKFDPL-KDLNLPTYAKPIVIREEIDRPQPRLDRNE 306 GH ES++ + A E++ + + + P + KP+V R E+DRPQPRLDR E Sbjct: 244 HGHLESVYAYLSKPASVEDVVQAWESWRPWGSEKPFMAPEKPVVYRREVDRPQPRLDRME 303 Query: 307 GNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVKK 352 G GMS V GR R + Y L HN IRGAAG ++L AE ++ Sbjct: 304 GGGMSSVTGRARMVEDRLLAYLVLGHNLIRGAAGNAILIAEMLARE 349 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 352 Length adjustment: 29 Effective length of query: 325 Effective length of database: 323 Effective search space: 104975 Effective search space used: 104975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_014026421.1 PYRFU_RS04350 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR00978 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00978.hmm # target sequence database: /tmp/gapView.13453.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00978 [M=342] Accession: TIGR00978 Description: asd_EA: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-135 437.2 0.0 2.3e-135 437.0 0.0 1.0 1 lcl|NCBI__GCF_000223395.1:WP_014026421.1 PYRFU_RS04350 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014026421.1 PYRFU_RS04350 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.0 0.0 2.3e-135 2.3e-135 1 340 [. 5 346 .. 5 348 .. 0.98 Alignments for each domain: == domain 1 score: 437.0 bits; conditional E-value: 2.3e-135 TIGR00978 1 vkvavLGatGlvGqklvkllekhpyfelakvvaserkaGkkygevvkwilsgdipeevrdleiketepa 69 +++avLGatGlvGq +vkll++hp+fe++ v+aser+aG++y e+v+w+l g pe++ +++++++ + lcl|NCBI__GCF_000223395.1:WP_014026421.1 5 LRAAVLGATGLVGQMFVKLLDEHPMFEIVYVAASERSAGRSYCEAVNWVLGGSPPESLCGIKVEKVGVD 73 689**************************************************************9988 PP TIGR00978 70 ae.ekdvdlvfsalpsevaeevEkklaeeGlevfsnasalRldpdvplivpEvnsdhlellkvqker.g 136 + + +vd+vfsalps+va+e+E+ la++G++v+snas++Rl++dvpl+vpE+n+dh+ l+k q++r g lcl|NCBI__GCF_000223395.1:WP_014026421.1 74 NVpKSEVDVVFSALPSSVAGEIEAGLARRGFTVVSNASPMRLEEDVPLLVPEINWDHVGLVKIQRQRrG 142 777999***********************************************************999* PP TIGR00978 137 wkGvivtnpnCstailtlalkPlidaasikkvivatlqavsGAGypGvssldildnviPyikgEEekie 205 w+G i +npnCs ail l+lkPl+d+++++kv v+t+qavsGAGy+Gv+s++ildn++P+i +EEek++ lcl|NCBI__GCF_000223395.1:WP_014026421.1 143 WSGAIYKNPNCSSAILVLSLKPLLDNFGLEKVLVTTMQAVSGAGYNGVPSMAILDNIVPFIAKEEEKLA 211 ********************************************************************* PP TIGR00978 206 kEtkkilGkleegkvepaelevsatttRvPvleGHtesvfveldkkldieeirealkefkklpqklglp 274 +E++kilG ++++ve a + + atttRvPvl+GH+esv+ l+k ++e++++a+++++ ++ + lcl|NCBI__GCF_000223395.1:WP_014026421.1 212 NEPRKILGVYRGDRVEWARFTIHATTTRVPVLHGHLESVYAYLSKPASVEDVVQAWESWRPWGSEKPF- 279 *************************************************************9777766. PP TIGR00978 275 saPekpivlldeedrPqprldldaekgmavtvGrlreese.slklvvlghnlvRGAAGaallnaEll 340 aPekp+v+++e drPqprld+ ++gm+ + Gr r ++ l + vlghnl+RGAAG a+l aE+l lcl|NCBI__GCF_000223395.1:WP_014026421.1 280 MAPEKPVVYRREVDRPQPRLDRMEGGGMSSVTGRARMVEDrLLAYLVLGHNLIRGAAGNAILIAEML 346 689*********************************9988799**********************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.50 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory