Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_014026435.1 PYRFU_RS04420 triose-phosphate isomerase
Query= BRENDA::P62002 (228 letters) >NCBI__GCF_000223395.1:WP_014026435.1 Length = 230 Score = 225 bits (574), Expect = 5e-64 Identities = 115/221 (52%), Positives = 160/221 (72%), Gaps = 3/221 (1%) Query: 8 IIAINFKTYIEATGKRALEIAKAAEKVYKETG--VTIVVAPQLVDLRMIAESVE-IPVFA 64 I+A+NFK Y A G+RALE+ KAAE+V +E V++++AP ++ I+ SVE + V+A Sbjct: 6 ILAVNFKVYPSAFGRRALEVVKAAERVAREFEGTVSVIIAPPHTEIARISSSVERVIVYA 65 Query: 65 QHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMVCS 124 QH+DP++PG+HTG V EAVKEAGA G+L+NHSE ++ L ++E + R + VGL +VC+ Sbjct: 66 QHVDPVEPGAHTGSVPVEAVKEAGARGSLVNHSERKLRLDEIERVVERLKVVGLEQLVCA 125 Query: 125 NNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVLCGAG 184 + P +AA+A P YVAVEPPELIGTGI VS+AKPEV+T VE V +V+P V VL GAG Sbjct: 126 DTPRAAAAIAVFEPTYVAVEPPELIGTGIAVSRAKPEVVTKAVESVTRVSPNVPVLVGAG 185 Query: 185 ISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGI 225 I + ED ++++ELG GVL+AS V KA DP + +L G+ Sbjct: 186 IVSREDARRSVELGARGVLVASAVMKAADPYAKMRELAEGL 226 Lambda K H 0.314 0.132 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 230 Length adjustment: 23 Effective length of query: 205 Effective length of database: 207 Effective search space: 42435 Effective search space used: 42435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_014026435.1 PYRFU_RS04420 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.8920.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-56 175.5 5.5 1.3e-55 174.7 5.5 1.3 1 lcl|NCBI__GCF_000223395.1:WP_014026435.1 PYRFU_RS04420 triose-phosphate i Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014026435.1 PYRFU_RS04420 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.7 5.5 1.3e-55 1.3e-55 2 227 .. 7 212 .. 6 213 .. 0.94 Alignments for each domain: == domain 1 score: 174.7 bits; conditional E-value: 1.3e-55 TIGR00419 2 viinfK.lnesvgkvelevaklaeevasea..gvevavappfvdldvvkdeveseiqvaAqnvdavksG 67 + +nfK + ++g+++lev k ae va e v+v +app+ + +++ ve ++ v+Aq+vd v++G lcl|NCBI__GCF_000223395.1:WP_014026435.1 7 LAVNFKvYPSAFGRRALEVVKAAERVAREFegTVSVIIAPPHTEIARISSSVE-RVIVYAQHVDPVEPG 74 679***9********************97522688999***************.999************ PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 a+tG++ e++k++Ga+g+l++HsEr+ l++ + ie +v rlk gl+ +vC + lcl|NCBI__GCF_000223395.1:WP_014026435.1 75 AHTGSVPVEAVKEAGARGSLVNHSERK--LRLDE--IERVVERLKVVGLEQLVCA-------------D 126 ***************************..99999..*******************.............4 PP TIGR00419 137 nvattaaaaAlepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaae 205 + aa+a +ep +vAvEP+eliGtG++vs+A++evv+k v+ + v+++v vl+Ga++ + e lcl|NCBI__GCF_000223395.1:WP_014026435.1 127 TPRAAAAIAVFEPTYVAVEPPELIGTGIAVSRAKPEVVTKAVE-----SVTRVSPNVPVLVGAGIVSRE 190 4444455555*********************************.....9999***************** PP TIGR00419 206 daelaaqldvdGvLlasavlka 227 da+ ++l++ GvL+asav+ka lcl|NCBI__GCF_000223395.1:WP_014026435.1 191 DARRSVELGARGVLVASAVMKA 212 *********************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (230 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 2.59 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory