Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_014026630.1 PYRFU_RS05405 TrpB-like pyridoxal phosphate-dependent enzyme
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000223395.1:WP_014026630.1 Length = 429 Score = 458 bits (1179), Expect = e-133 Identities = 234/423 (55%), Positives = 299/423 (70%), Gaps = 15/423 (3%) Query: 8 LPKYWYNIIPDLPKPLPPPRDPQGAYFSRIDLLRSILPKEVLRQQFTIERYIKIPEEVRD 67 +P WYNI+ DLP PLPP DP SRI LL ILP ++ +++T+ R++ IP+EVR Sbjct: 4 VPSRWYNIVADLPVPLPPLIDPLDDEGSRIQLLVRILPSRLIDEEYTLSRFLDIPDEVRA 63 Query: 68 RYLSIGRPTPLFRAKRLEEYLKTPAR--IYFKYEGATPTGSHKINTAIPQAYFAKEEGIE 125 Y +GRPTPL RA+ LE+ L R IY+K+EGA PTGSHKINTAIPQ Y+AK +G Sbjct: 64 AYRKVGRPTPLIRAEGLEKALGVHGRVRIYYKFEGALPTGSHKINTAIPQVYYAKLDGAN 123 Query: 126 HVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLT 185 V TETGAGQWG AVA AA++ MK+TIFM + SY K RR +MQL GA V+ SP+ +T Sbjct: 124 EVATETGAGQWGLAVATAAAILGMKATIFMTRSSYHSKRQRRLLMQLLGATVHPSPSEVT 183 Query: 186 EYGRKILETNPQHPGSLGIAMSEAIEYAL-KNEFRYLVGSVLDVVLLHQSVIGQETITQL 244 E GR+ L NP+HPGSLG+A++EA+EY L N+ RY+ GSVL+ VL HQ+VIG E + QL Sbjct: 184 EAGRRALRENPEHPGSLGLAITEAVEYVLSSNDRRYVAGSVLESVLTHQTVIGMEVLEQL 243 Query: 245 DLLGEDADILIGCVGGGSNFGGFTYPFIGNK------KGKRYIAVSSAEIPKFSKGEYKY 298 E+ D +I CVGGGSN GGF+YP +G K + R+IA + +P+ SKGEY+Y Sbjct: 244 P---EEPDYMIACVGGGSNMGGFSYPALGMKLRSEGFEKTRFIAAEATAVPRLSKGEYRY 300 Query: 299 DFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNEREIF 358 D D+ +LPL KM TLGKDYVPPPI+A GLRYHG AP+LSLL K G +E R Y + E++ Sbjct: 301 DGLDTGLVLPLAKMYTLGKDYVPPPIHAAGLRYHGAAPSLSLLRKLGYIEARAYTQEEVY 360 Query: 359 EAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMM 418 EA K+F ++GI+PAPES HAIRAV+D A A ++ VIVFNLSGHGLLD +E + Sbjct: 361 EAGKLFARSEGIIPAPESTHAIRAVIDIAKRAPQDT---VIVFNLSGHGLLDTDAFEKIE 417 Query: 419 KRL 421 R+ Sbjct: 418 SRI 420 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 429 Length adjustment: 32 Effective length of query: 393 Effective length of database: 397 Effective search space: 156021 Effective search space used: 156021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory