Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_014026985.1 PYRFU_RS07130 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >NCBI__GCF_000223395.1:WP_014026985.1 Length = 235 Score = 114 bits (286), Expect = 1e-30 Identities = 76/231 (32%), Positives = 114/231 (49%), Gaps = 5/231 (2%) Query: 7 LPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRAL 66 +P++D+ G+ V+ V G GT GSPLE A G EWLH+VDLD A Sbjct: 1 MPSLDLEAGRVVKRVEGVKGTGLVVGSPLEVAKRLWEKGVEWLHVVDLDGAEAGKPVNVG 60 Query: 67 IAEVAQAMDIKVELSGGIRDDDTLAAAL-ATGCTRVNLGTAALETPEWVAKVIAEH-GDK 124 IAE M V+ GGIR + + L G RV +GT P V V+ E+ GD+ Sbjct: 61 IAESLVRMGFHVQYGGGIRAKEHVELLLDKIGVERVVIGTLVHRNPRLVEDVVEEYGGDR 120 Query: 125 IAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKN 184 I LD + + GW ++ L + LD + G + + T + ++G L G +LE + Sbjct: 121 IVAALDAKWGMVVIEGWRKEAKSLRDMLDLVYGLGVRQILYTSVEREGKLTGADLERVAW 180 Query: 185 VCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEA 235 + + +GG++++DD I GL GV+ AI+G A +A + EA Sbjct: 181 LRGVWPYGLQYAGGIATIDD---ILGLAELGVDAAILGMAFHAGLLDVVEA 228 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 235 Length adjustment: 23 Effective length of query: 217 Effective length of database: 212 Effective search space: 46004 Effective search space used: 46004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory