Align anthranilate phosphoribosyltransferase (EC 2.4.2.18) (characterized)
to candidate WP_014027355.1 PYRFU_RS08955 anthranilate phosphoribosyltransferase
Query= BRENDA::Q9YGB4 (325 letters) >NCBI__GCF_000223395.1:WP_014027355.1 Length = 345 Score = 256 bits (655), Expect = 4e-73 Identities = 157/329 (47%), Positives = 211/329 (64%), Gaps = 12/329 (3%) Query: 3 LLAKIVDGKNLSFEEAYEL-FNELKGS-DGVLIGAYLAALQTKGYTGEELAGLARAMRDS 60 LL KI+ G L+ +EA E+ LKG D V I A L AL+ +G T E +AG A A+R++ Sbjct: 7 LLEKILSGPGLTHQEAREIALMMLKGGIDDVGIAAILVALRARGETPEVVAGFAAALRET 66 Query: 61 AVKLDLG---KVADTAGTGGDGSSTINVSTASALILSAF-TRVAKHGNVSITSKSGSANV 116 VK+ + + DTAGTGGD S TIN STA+AL SA V KHGN S++SKSGSA+ Sbjct: 67 CVKVQVPPGVEPIDTAGTGGDRSHTINASTAAALAASALGAYVLKHGNRSVSSKSGSADF 126 Query: 117 LEALGLNIRVSPERAREMVESTNFTFIFAPAYHPALRPIMPVRKALGIKTVFNVIGPLAN 176 LE LG I P+ AR M+E F F++AP YHPA++ +MPVR+ LGI+TVFN++GPL+N Sbjct: 127 LERLGYKIDHGPDEARCMLEKARFAFLYAPRYHPAMKRVMPVRRKLGIRTVFNLVGPLSN 186 Query: 177 PADPAYQVVGVNSPELLEPVAEALEFLGVERALVVHGS-GMDEVSPHRETLV--LEVGNG 233 P QV+GV SP+LLE +++A LG ER LVVHG G+DEVS T V +E G+ Sbjct: 187 PGLVKRQVLGVASPQLLETMSKAGAILGYERLLVVHGEPGIDEVSVTGATTVVLVEKGSV 246 Query: 234 VERYTLSPEDFGIE--PVKPLPCSSPEESAARIKAVLGGSGRREDRDFILVNASAALYAS 291 ++ +PE+ G + P+ L +P ES R++ V G G D DFI VN ALYA+ Sbjct: 247 LDTVRYTPEELGAKRHPLHLLRVETPGESVERVRRVFQGEGAPHDTDFIAVNTGFALYAA 306 Query: 292 GVAEDFREGLEMAREALGQGML-EKLEEI 319 GV + REG+E+ ++AL +G L E LE + Sbjct: 307 GVVSEPREGVELFKQALAEGRLAEHLENV 335 Lambda K H 0.314 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 345 Length adjustment: 28 Effective length of query: 297 Effective length of database: 317 Effective search space: 94149 Effective search space used: 94149 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_014027355.1 PYRFU_RS08955 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.27512.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-115 370.7 0.0 4e-115 370.6 0.0 1.0 1 lcl|NCBI__GCF_000223395.1:WP_014027355.1 PYRFU_RS08955 anthranilate phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014027355.1 PYRFU_RS08955 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.6 0.0 4e-115 4e-115 1 328 [. 8 336 .. 8 338 .. 0.98 Alignments for each domain: == domain 1 score: 370.6 bits; conditional E-value: 4e-115 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeese 69 lek+l++ L+++ea+++ ++++g ++d+ iaAilvalr++get+e +ag+a alre+ +kv++ + lcl|NCBI__GCF_000223395.1:WP_014027355.1 8 LEKILSGPGLTHQEAREIALMMLKGGIDDVGIAAILVALRARGETPEVVAGFAAALRETCVKVQVPPGV 76 68999999************************************************************* PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 e +D++GTGGD ++tiN STa+al a+a+G+ v KhGnrsvssksGsaD+Le lg+++++ p++++ +l lcl|NCBI__GCF_000223395.1:WP_014027355.1 77 EPIDTAGTGGDRSHTINASTAAALAASALGAYVLKHGNRSVSSKSGSADFLERLGYKIDHGPDEARCML 145 ********************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 e+ ++Fl+AP+yhpa+k+v+pvR++Lg+rtvfNl+GPL+nP +k+qvlGv+s++l+e+++++ lg lcl|NCBI__GCF_000223395.1:WP_014027355.1 146 EKARFAFLYAPRYHPAMKRVMPVRRKLGIRTVFNLVGPLSNPGLVKRQVLGVASPQLLETMSKAGAILG 214 ********************************************************************* PP TIGR01245 208 vkralvvhgedglDEisltgetkvaelkdgeie.eytlspedfglkraeleelkggsaeenaellkevl 275 ++r lvvhge g+DE+s+tg t+v+ +++g++ + + +pe++g kr++l+ l+++++ e++e++++v+ lcl|NCBI__GCF_000223395.1:WP_014027355.1 215 YERLLVVHGEPGIDEVSVTGATTVVLVEKGSVLdTVRYTPEELGAKRHPLHLLRVETPGESVERVRRVF 283 ******************************99615789******************************* PP TIGR01245 276 egkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelv 328 +g++ +++d++++N+++aly+ag++++ +egvel k+a+ +g+ +e+le++ lcl|NCBI__GCF_000223395.1:WP_014027355.1 284 QGEGAPHDTDFIAVNTGFALYAAGVVSEPREGVELFKQALAEGRLAEHLENVL 336 **************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory