Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_014146969.1 MEALZ_RS02265 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000968535.2:WP_014146969.1 Length = 404 Score = 371 bits (952), Expect = e-107 Identities = 206/395 (52%), Positives = 263/395 (66%), Gaps = 8/395 (2%) Query: 16 IDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDEDGVR 75 +DGI L TA AG+K+ DL LI + GST AVFT N FCAAPV +AK HL + R Sbjct: 14 VDGIELGTACAGIKQTQRDDLLLIQMREGSTCAAVFTQNAFCAAPVVVAKEHL--QQAPR 71 Query: 76 ALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKIIAAL 135 L+IN+GNANAGTG +G DAL+ CA A G QV+PFSTGVI EPL DKI AAL Sbjct: 72 WLLINSGNANAGTGKRGLDDALSTCADLAELAGADARQVLPFSTGVIGEPLAVDKIKAAL 131 Query: 136 PK----MQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNMATM 191 PK + W +AARAIMTTDT PK AS +G + T+ TGI+KG+GMI PNMATM Sbjct: 132 PKAFANLAEDHWEQAARAIMTTDTFPKGASFTLGIGGE-TITLTGISKGAGMIQPNMATM 190 Query: 192 LGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEIDNIAD 251 L FIATDAK+ + +LQ A+ +FN ITVDGDTSTND+ V++A+G + E+ Sbjct: 191 LSFIATDAKIERELLQACLARAAELSFNRITVDGDTSTNDACVLMASGCSKVPELTE-GS 249 Query: 252 PRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAARSPLVKT 311 P Y + + + +L++AIVRDGEGATK + + + A +EA + A A SPLVKT Sbjct: 250 PAYQVFADAVLKICKQLSEAIVRDGEGATKLMRIVINQALDDEEAVRVAKTIAHSPLVKT 309 Query: 312 AFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQAVMSKD 371 AFFASDPN G+ LAA+G A V ++D + V+++L D+ + GGRA YTEA GQ VM++ Sbjct: 310 AFFASDPNWGRILAAVGRAGVDNMDLERVDIHLGDVCIVRGGGRAEDYTEAAGQRVMNEP 369 Query: 372 EITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 EITV + L RG A+ V TCD S+ YV INA+YR+ Sbjct: 370 EITVTVTLGRGSASQEVLTCDFSYDYVRINAEYRT 404 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 404 Length adjustment: 31 Effective length of query: 375 Effective length of database: 373 Effective search space: 139875 Effective search space used: 139875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory