Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_014148952.1 MEALZ_RS12220 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000968535.2:WP_014148952.1 Length = 361 Score = 384 bits (985), Expect = e-111 Identities = 197/365 (53%), Positives = 251/365 (68%), Gaps = 4/365 (1%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 M+ L LR RID++DE+IL LI++RA CA EVA+ K A + E FYRP+RE+ V Sbjct: 1 MTSITPLADLRARIDAIDEQILQLINQRASCAIEVAKTKMA---EGESGCFYRPDRESLV 57 Query: 61 LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120 L+ + LN+GPL +E R FRE+MS+CLALE+PL VA+LGPEGTF+Q AA+KHFGH+V Sbjct: 58 LRRVKALNQGPLADETAMRFFRELMSACLALEKPLDVAFLGPEGTFTQQAAIKHFGHAVN 117 Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180 + P I E+F V FGVVPVENSTEG VNHTLD F+ + ICGEVELR+HH+L Sbjct: 118 AVPAMTIAEIFNAVENEHCQFGVVPVENSTEGVVNHTLDRFVSSPLKICGEVELRVHHNL 177 Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240 +G I ++SH QSLAQCR+WLD H P+ +R AV+SN +AA+ + AAIA Sbjct: 178 -IGNAGSLADIAEVFSHQQSLAQCRQWLDLHLPDAKRTAVNSNGEAARLAAGSKDKAAIA 236 Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300 G AA+LYGLS + IED N+TRF+IIG Q PTG DKTS++VS N+PGAL+ +L Sbjct: 237 GKFAAELYGLSVIERNIEDESNNTTRFIIIGRQISGPTGKDKTSLLVSTGNQPGALYRVL 296 Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360 PF +GI + IE+RPSR G W YVFFID GH +D + L+ +G L +LGSY Sbjct: 297 EPFAHHGIGMMHIESRPSRQGLWDYVFFIDIEGHAEDENVAAALKMLGARVSMLNILGSY 356 Query: 361 PKAVL 365 PKAVL Sbjct: 357 PKAVL 361 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 361 Length adjustment: 29 Effective length of query: 336 Effective length of database: 332 Effective search space: 111552 Effective search space used: 111552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_014148952.1 MEALZ_RS12220 (prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.3691508.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-30 90.5 0.1 6.1e-30 89.6 0.1 1.5 1 NCBI__GCF_000968535.2:WP_014148952.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000968535.2:WP_014148952.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.6 0.1 6.1e-30 6.1e-30 1 76 [] 7 82 .. 7 82 .. 0.99 Alignments for each domain: == domain 1 score: 89.6 bits; conditional E-value: 6.1e-30 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkksaseaviYRPeREaavlrrlkelnkGpLdqeavarifrEi 75 L++lR++iDaiD++il+L+++Ra +a +v++ K + + + +YRP+RE vlrr+k ln+GpL +e r frE+ NCBI__GCF_000968535.2:WP_014148952.1 7 LADLRARIDAIDEQILQLINQRASCAIEVAKTKMAEGESGCFYRPDRESLVLRRVKALNQGPLADETAMRFFREL 81 789***********************************************************************9 PP TIGR01807 76 m 76 m NCBI__GCF_000968535.2:WP_014148952.1 82 M 82 8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.80 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory