Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_014148953.1 MEALZ_RS12225 3-phosphoserine/phosphohydroxythreonine transaminase
Query= BRENDA::P23721 (362 letters) >NCBI__GCF_000968535.2:WP_014148953.1 Length = 360 Score = 375 bits (964), Expect = e-109 Identities = 186/359 (51%), Positives = 246/359 (68%), Gaps = 2/359 (0%) Query: 1 MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL 60 MA+I+NFS+GP+ LP VL+QA+ E+ +W G SVME+SHRGK F +AE+ E D R+L Sbjct: 1 MARIYNFSAGPSALPEAVLRQARDEMLEWQASGMSVMEMSHRGKHFSNIAEQLEVDLREL 60 Query: 61 LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD 120 + +P NYKVLF GG GQF+ +PLN+L KT A Y++ G W+ AIK+ ++C V Sbjct: 61 MAIPDNYKVLFLQGGATGQFSFIPLNLLRGKTKACYINTGAWSEKAIKDGGRFCEV-VVS 119 Query: 121 AKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTIL 180 A + + + EWQ+ +AAY+HY NETI G+ PD + + +D SS IL Sbjct: 120 ASSESEKFTTIPAVAEWQIEPDAAYLHYTSNETIHGVEFPFIPD-AQGLPLVSDMSSNIL 178 Query: 181 SRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNT 240 SR +DVS++G+IYAG QKN+GPAG+T+VIVR+DL+G+ + P + +Y++ N SM NT Sbjct: 179 SRKVDVSQFGLIYAGTQKNMGPAGVTVVIVRDDLIGETDSRLPDVFNYAVQAKNQSMLNT 238 Query: 241 PPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNV 300 P T+ WYL GLV KWLK+ GGV ++ +N +KA LY ID S Y N V RSRMNV Sbjct: 239 PATYNWYLVGLVLKWLKSAGGVGAIEAVNIRKAASLYDAIDRSSLYSNPVQTEFRSRMNV 298 Query: 301 PFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFER 359 PF L+D++LDK FL ++ A G LKGHR VGGMRASIYNAMP EGVKAL +FM EFER Sbjct: 299 PFILSDASLDKEFLSQAEANGFAELKGHRSVGGMRASIYNAMPEEGVKALIEFMAEFER 357 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 360 Length adjustment: 29 Effective length of query: 333 Effective length of database: 331 Effective search space: 110223 Effective search space used: 110223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_014148953.1 MEALZ_RS12225 (3-phosphoserine/phosphohydroxythreonine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.15971.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-160 518.5 0.0 4.5e-160 518.3 0.0 1.0 1 lcl|NCBI__GCF_000968535.2:WP_014148953.1 MEALZ_RS12225 3-phosphoserine/ph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000968535.2:WP_014148953.1 MEALZ_RS12225 3-phosphoserine/phosphohydroxythreonine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.3 0.0 4.5e-160 4.5e-160 1 356 [. 4 357 .. 4 359 .. 0.99 Alignments for each domain: == domain 1 score: 518.3 bits; conditional E-value: 4.5e-160 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 i+nFsaGP+alpe+vl++a++e+l+++ +g+svme+sHR k+f++++e+ e dlreL+ ipdny+vlfl lcl|NCBI__GCF_000968535.2:WP_014148953.1 4 IYNFSAGPSALPEAVLRQARDEMLEWQASGMSVMEMSHRGKHFSNIAEQLEVDLRELMAIPDNYKVLFL 72 69******************************************************************* PP TIGR01364 70 qGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelke 138 qGGat+qf+ +plnll+ k++a yi+tGaws+ka+k+ ++++ v v as+e++k+++ip e+++++ lcl|NCBI__GCF_000968535.2:WP_014148953.1 73 QGGATGQFSFIPLNLLRGKTKACYINTGAWSEKAIKDGGRFCE-VVVSASSESEKFTTIPAVAEWQIEP 140 *****************************************99.99999999***************** PP TIGR01364 139 daayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivr 207 daay+++++neti+Gvef +p+ + plv+D+ss+ilsrk+dvs++gliyaG+qKn+GpaGvtvvivr lcl|NCBI__GCF_000968535.2:WP_014148953.1 141 DAAYLHYTSNETIHGVEFPFIPDAQGLPLVSDMSSNILSRKVDVSQFGLIYAGTQKNMGPAGVTVVIVR 209 ********************************************************************* PP TIGR01364 208 kdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeai 276 +dl++++ + lp+v++Y+++a+n+s++ntp+t+++y++glvlkwlk+ GGv ++e+ n +Ka+ lY+ai lcl|NCBI__GCF_000968535.2:WP_014148953.1 210 DDLIGETDSRLPDVFNYAVQAKNQSMLNTPATYNWYLVGLVLKWLKSAGGVGAIEAVNIRKAASLYDAI 278 ********************************************************************* PP TIGR01364 277 desegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpleevq 345 d+s+ +y n+v+ + Rs+mnv+F l+++ l+keFl++ae++g+ +lkGhrsvGG+RasiYna+p e+v+ lcl|NCBI__GCF_000968535.2:WP_014148953.1 279 DRSS-LYSNPVQTEFRSRMNVPFILSDASLDKEFLSQAEANGFAELKGHRSVGGMRASIYNAMPEEGVK 346 *997.**************************************************************** PP TIGR01364 346 aLvdfmkeFek 356 aL++fm eFe+ lcl|NCBI__GCF_000968535.2:WP_014148953.1 347 ALIEFMAEFER 357 *********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory