Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_014448409.1 LFE_RS00950 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000284315.1:WP_014448409.1 Length = 311 Score = 171 bits (433), Expect = 2e-47 Identities = 107/303 (35%), Positives = 167/303 (55%), Gaps = 17/303 (5%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 + + K VP++DA + V TH+LHYG A F G+R PE +FRL H RL S K Sbjct: 9 WMDGKMVPWKDANVHVLTHSLHYGMAVFEGIRAYSGPEGTS---IFRLAEHTRRLVNSGK 65 Query: 69 --FLHYDISAEKIKEVIVDFVKKNQPDKSFYIRPLVYSS--GLGIAPRLHNLEKDFLVYG 124 + S E++ + V++N S YIRPL+Y +GI R + + + Sbjct: 66 VMLMKSPYSEEELMDATCRVVRENNLS-SCYIRPLMYVGYGDMGIYARQNPICVSISAW- 123 Query: 125 LEMGDYLAADGVS----CRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 E G YL +G+S +ISS+ R +F R K+SA Y+ S LAK E +G+DEAI Sbjct: 124 -EWGTYLGEEGLSKGIRAKISSFSRFGVNTFLNRAKVSAHYVNSQLAKWEVKMAGYDEAI 182 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 L++ G V E G N+F+V G + TP + +L+GITR+++ T+A ++GIP + + + Sbjct: 183 LLDQDGFVAEGPGENIFIVSGGVLRTPA-LKTVLDGITRNAVQTLAKEMGIPVWEGVLTR 241 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLRSVLTAVTENREPKYQDWV 298 +L +ADE F +GTAA++TP++ I+ T+G R P+T L+ V + +W Sbjct: 242 DDLYLADEAFFTGTAAELTPIREIDERTIGTGRPGPVTLALQKAFFDVVHGHVKDHSEWR 301 Query: 299 FKI 301 + + Sbjct: 302 YPV 304 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 311 Length adjustment: 27 Effective length of query: 278 Effective length of database: 284 Effective search space: 78952 Effective search space used: 78952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory