Align 3-isopropylmalate dehydratase large subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate WP_014449968.1 LFE_RS09315 aconitate hydratase
Query= curated2:Q9WYC7 (418 letters) >NCBI__GCF_000284315.1:WP_014449968.1 Length = 640 Score = 296 bits (757), Expect = 2e-84 Identities = 161/416 (38%), Positives = 235/416 (56%), Gaps = 4/416 (0%) Query: 1 MGKTLAEKIFSEH-VGRDVKAGEIVLARVDIAMAQDGTGPLMINEFRELGFKEVKVPKAF 59 M L +KIF EH V ++ AG+ V R+D + QD TG + +F LG VK + Sbjct: 1 MALNLTQKIFKEHLVSGEIVAGKEVAIRIDQTLTQDATGTMAYLQFEALGLDRVKTELSV 60 Query: 60 LFIDHASPSPRKELSNSQKMMREFGKEMGVKVFDAGDGISHQILAEKYVKPGDLVAGADS 119 ++DH E ++ + ++ G+ G+GI HQ+ E++ KPG + G+DS Sbjct: 61 SYVDHNMLQTGFENADDHRYLQTVAARYGIVFSRPGNGICHQVHLERFGKPGKTLLGSDS 120 Query: 120 HTCTAGGLGAFGTGMGSTDVAIIFGLGQNWFKVPETIKVVVNGKLQDGVYAKDIILEIAR 179 HT T GG+G G G DVA+ G +P+ ++V + G+LQ V AKD+ILE+ R Sbjct: 121 HTPTNGGVGMIAIGAGGLDVALAMGGEAFHLSMPKVVQVKLTGRLQPFVSAKDVILELLR 180 Query: 180 ILGSDGATYKALEFHGSCIENMNVEDRLTISNMAVEVGAKAGLMPSDEKTREFLKKMGRE 239 L G + E+ G + +++V +R TI+NM E+GA + PSDE+TRE+LK GRE Sbjct: 181 RLTVKGGVNRIFEYTGEGVLSLSVPERSTITNMGAELGATTSIFPSDERTREYLKAQGRE 240 Query: 240 EDFRELKADPDAVYETEIEIDATTLEPLVSLPHYVDNVRKVSEVEKEKIKIDQVFIGTCT 299 +D+R ADP A Y+ +EID TLEPL++ PH DNV KV ++ + I + QV IG+CT Sbjct: 241 KDYRAYAADPGASYDETVEIDLDTLEPLIAQPHSPDNVVKVRDI--QGIPVSQVAIGSCT 298 Query: 300 NGRLQDLEIALKILEKHGKHPDVRLIVGPASRKVYMDALEKGIIKKFVELGAAVIPPGCG 359 N +DL +++ P V L P SR+ + G++ + GA ++ CG Sbjct: 299 NSSFKDLMTISHLMKGKMVSPGVSLGFSPGSRQTLEMISQNGVLGNMITAGARLLESACG 358 Query: 360 PCVGIHMGVLGDGERVLSTQNRNFKGRMGNPNAEIYLASPATAAATAVTGYITDPR 415 PC+G+ G V T NRNF+GR G +A++YLASP AAA A+TG ITDPR Sbjct: 359 PCIGMGFAPPSGGVSV-RTFNRNFEGRSGTKDAKVYLASPEVAAACAITGVITDPR 413 Lambda K H 0.318 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 644 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 640 Length adjustment: 35 Effective length of query: 383 Effective length of database: 605 Effective search space: 231715 Effective search space used: 231715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory