Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate WP_015738236.1 ADEG_RS00925 glutamate 5-kinase
Query= metacyc::AT2G39800-MONOMER (717 letters) >NCBI__GCF_000024605.1:WP_015738236.1 Length = 373 Score = 157 bits (398), Expect = 7e-43 Identities = 102/275 (37%), Positives = 154/275 (56%), Gaps = 21/275 (7%) Query: 15 KRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSSGAVGLGRQRLRYRQ 74 +R+VVKVGT+ +T G L L ++ L ++LA ++ +G EV+LVSSGA+G G RL R Sbjct: 10 RRLVVKVGTSSITLPSGELNLEQIAKLVDELAAVHREGKEVLLVSSGAIGAGMGRLGLRS 69 Query: 75 LVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQLLVNDSSFRDKDFR 134 +P+T + +ACA VGQ LM YE F +T Q+L+ F + Sbjct: 70 ----------RPRTIPEKQACAAVGQGLLMQIYERFFSSHGITVGQVLLTRDDFAHRRRF 119 Query: 135 KQLNETVKSMLDLRVIPIFNENDAISTRRAPYQDSSGIFWDNDSLAALLALELKADLLIL 194 T+ ++L+ RV+PI NEND ++ DND+L+AL+A + A+LL++ Sbjct: 120 LNARNTLLTLLEYRVVPIINENDTVAVEEIR-------LGDNDTLSALVASLINAELLLI 172 Query: 195 LSDVEGLYTGPP-SDPNSKLIHTFVKEKHQD--EITFGDKSRLGRGGMTAKVKAAVNAAY 251 LSDV+GLYTG P DP ++LI + VKE + + G S++G GGM K++AA A Sbjct: 173 LSDVDGLYTGDPRRDPQARLI-SEVKELTPEIWALAGGPGSQVGSGGMLTKLEAARIAGR 231 Query: 252 AGIPVIITSGYSAENIDKVLRGLRVGTLFHQDARL 286 +G ++I I +VL G +GT+F +L Sbjct: 232 SGCTLVIARASLPGVIRRVLAGEEIGTVFFPREKL 266 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 373 Length adjustment: 35 Effective length of query: 682 Effective length of database: 338 Effective search space: 230516 Effective search space used: 230516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory