Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_015738276.1 ADEG_RS01155 3-isopropylmalate dehydratase small subunit
Query= BRENDA::Q58673 (168 letters) >NCBI__GCF_000024605.1:WP_015738276.1 Length = 163 Score = 197 bits (501), Expect = 7e-56 Identities = 90/161 (55%), Positives = 126/161 (78%), Gaps = 1/161 (0%) Query: 4 IIKGRVWKFGNNVDTDAILPARYLVYTKPEELAQFVMTGADPDFPKKVKPGDIIVGGKNF 63 +I+GRV+KFG+++DTD I+PARYL T P ELA+ + ADP F ++V+PGD+IV G NF Sbjct: 1 MIEGRVFKFGDHIDTDLIIPARYLNTTDPAELAKHCLEDADPSFAREVRPGDVIVAGVNF 60 Query: 64 GCGSSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVN 123 GCGSSREHAPL +K AG++CV+A+SFARIFYRNA N+GLPL+EC + ++ G + V+ Sbjct: 61 GCGSSREHAPLAIKAAGVACVVAQSFARIFYRNAFNIGLPLLECPD-APRIPAGSRVRVD 119 Query: 124 LETGEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKKKM 164 L++G I+ L TGEV + +P FM EI+ AGGL+PY++K++ Sbjct: 120 LQSGRIEVLDTGEVFTARPIPPFMQEIIAAGGLIPYVEKRL 160 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 163 Length adjustment: 18 Effective length of query: 150 Effective length of database: 145 Effective search space: 21750 Effective search space used: 21750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_015738276.1 ADEG_RS01155 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02087.hmm # target sequence database: /tmp/gapView.1104.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02087 [M=157] Accession: TIGR02087 Description: LEUD_arch: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-67 211.2 0.0 3.8e-67 211.0 0.0 1.0 1 lcl|NCBI__GCF_000024605.1:WP_015738276.1 ADEG_RS01155 3-isopropylmalate d Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015738276.1 ADEG_RS01155 3-isopropylmalate dehydratase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 211.0 0.0 3.8e-67 3.8e-67 1 157 [] 4 159 .. 4 159 .. 0.98 Alignments for each domain: == domain 1 score: 211.0 bits; conditional E-value: 3.8e-67 TIGR02087 1 GrvwkfGddvdtdaiiPgrylrttdlkelakhamegidpefakkvreGdvivaGknfGiGssreqaala 69 Grv+kfGd++dtd iiP+ryl ttd+ elakh++e++dp fa++vr+GdvivaG nfG+Gssre+a+la lcl|NCBI__GCF_000024605.1:WP_015738276.1 4 GRVFKFGDHIDTDLIIPARYLNTTDPAELAKHCLEDADPSFAREVRPGDVIVAGVNFGCGSSREHAPLA 72 9******************************************************************** PP TIGR02087 70 lkaaGvaaviaesfarifyrnainvGlplivaedvtelikdGdevevdlekgeirkvakkevlkleele 138 +kaaGva+v+a+sfarifyrna n+Glpl++ d+ i G +v+vdl++g+i + ev++ ++++ lcl|NCBI__GCF_000024605.1:WP_015738276.1 73 IKAAGVACVVAQSFARIFYRNAFNIGLPLLECPDA-PRIPAGSRVRVDLQSGRIEVLDTGEVFTARPIP 140 *********************************77.67778**************************** PP TIGR02087 139 dllleileeGGlleylkkr 157 ++ ei+++GGl+ y+ kr lcl|NCBI__GCF_000024605.1:WP_015738276.1 141 PFMQEIIAAGGLIPYVEKR 159 ***************9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (157 nodes) Target sequences: 1 (163 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 4.53 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory