Align Carbamoyl-phosphate synthase pyrimidine-specific small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_015738404.1 ADEG_RS01865 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P25993 (364 letters) >NCBI__GCF_000024605.1:WP_015738404.1 Length = 359 Score = 397 bits (1019), Expect = e-115 Identities = 189/354 (53%), Positives = 260/354 (73%), Gaps = 3/354 (0%) Query: 1 MKRRLVLENGAVFEGEAFGSLEHNMGEVVFNTGMTGYQEILSDPSYCGQIVTLTYPLIGN 60 M+ L LE+G VF G AFG+ GEVVF T MTGYQE+L+DPSYCGQIV LTYPL GN Sbjct: 1 MRALLALEDGTVFSGRAFGARGEVWGEVVFATAMTGYQEVLTDPSYCGQIVVLTYPLAGN 60 Query: 61 YGINRDDFESITPFVKGLIIKELCELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMI 120 YGIN +D E+ +V+GL+++E C PSNWRS TL E+L+ +PG++G+DTR LTR + Sbjct: 61 YGINLEDNEAGRVWVRGLVVREYCPTPSNWRSTCTLAEFLQTHGVPGIEGVDTRALTRRL 120 Query: 121 RTAGALKGTFASSDEDIEAVLK--RLNETELPRNQVSQVSAKTAYPSPGRGKRIVLVDFG 178 R G+++G ++ D D E+++ RL + + VS+V ++AY PG G R+V+VDFG Sbjct: 121 REHGSMRGVISTEDLDPESLVAKARLAPSLSEEDLVSEVVTRSAYTIPGEGPRVVVVDFG 180 Query: 179 MKHGILRELNKRKCDVIVVPYNITAEEVLQLKPDGIMLSNGPGDPKDVPEAIEMIKGVLG 238 +K ILR+L +R C+++VVP +A+E+L L P G++LSNGPGDP + A + +K +LG Sbjct: 181 VKQSILRQLRERGCELVVVPPTSSAQEILALAPQGVLLSNGPGDPSRLTGARDTVKALLG 240 Query: 239 KVPLFGICLGHQLFALACGANTEKMKFGHRGSNHPVKELATGKVALTSQNHGYTVSSIS- 297 +VPL GICLGHQ+ AL+ GA T K+KFGH G NHPVK+LATG+V +TS NHG+ V S Sbjct: 241 RVPLMGICLGHQVAALSLGARTFKLKFGHHGINHPVKDLATGRVFITSHNHGFAVDPASL 300 Query: 298 KTELEVTHIAINDDTIEGLKHKTLPAFTVQYHPEASPGPEDANHLFDRFIEMIE 351 ELEV++I++ND T+EGL+HK LP F+VQ+HPE PGP+DA +FDRF+E+++ Sbjct: 301 PPELEVSYISLNDGTVEGLRHKFLPFFSVQFHPEGGPGPQDAAFIFDRFLELLQ 354 Lambda K H 0.317 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 359 Length adjustment: 29 Effective length of query: 335 Effective length of database: 330 Effective search space: 110550 Effective search space used: 110550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_015738404.1 ADEG_RS01865 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.25163.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-152 493.2 0.0 2.4e-152 493.0 0.0 1.0 1 lcl|NCBI__GCF_000024605.1:WP_015738404.1 ADEG_RS01865 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015738404.1 ADEG_RS01865 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 493.0 0.0 2.4e-152 2.4e-152 1 360 [. 3 354 .. 3 355 .. 0.98 Alignments for each domain: == domain 1 score: 493.0 bits; conditional E-value: 2.4e-152 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a l+ledGtvf+g++fga++ev GevvF+T+mtGYqE+ltDpsY gqivvltypl gnyg+n ed+e+ lcl|NCBI__GCF_000024605.1:WP_015738404.1 3 ALLALEDGTVFSGRAFGARGEVWGEVVFATAMTGYQEVLTDPSYCGQIVVLTYPLAGNYGINLEDNEAG 71 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeel 138 +++v+glvv+e++ ++sn+r++ +L+efl+++g+++iegvDTRal+++lRe+gsm++viste+ + e+l lcl|NCBI__GCF_000024605.1:WP_015738404.1 72 RVWVRGLVVREYCPTPSNWRSTCTLAEFLQTHGVPGIEGVDTRALTRRLREHGSMRGVISTEDLDPESL 140 ********************************************************************* PP TIGR01368 139 vekakespkvkevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadt 207 v+ka+ +p+++e +lv+ev+t++ay++ eg rvvv+d+GvK++ilr+L +rg+e++vvp ++ lcl|NCBI__GCF_000024605.1:WP_015738404.1 141 VAKARLAPSLSEEDLVSEVVTRSAYTIPG----EGP--RVVVVDFGVKQSILRQLRERGCELVVVPPTS 203 **************************994....455..5****************************** PP TIGR01368 208 saeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrG 276 sa+ei +l p+g+llsnGPGdP++++ a +tvk+ll+ ++P++GIclGhq+ al+lga+t+klkfGh+G lcl|NCBI__GCF_000024605.1:WP_015738404.1 204 SAQEILALAPQGVLLSNGPGDPSRLTGARDTVKALLG-RVPLMGICLGHQVAALSLGARTFKLKFGHHG 271 *************************************.******************************* PP TIGR01368 277 aNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGp 345 Nhpvkdl+tgrv+its+NHg+avd++sl+ e lev +lnDgtvegl+hk lp+fsvQ+HPe+ pGp lcl|NCBI__GCF_000024605.1:WP_015738404.1 272 INHPVKDLATGRVFITSHNHGFAVDPASLPPE-LEVSYISLNDGTVEGLRHKFLPFFSVQFHPEGGPGP 339 ****************************9866.************************************ PP TIGR01368 346 hdteylFdefvelik 360 +d++++Fd+f+el++ lcl|NCBI__GCF_000024605.1:WP_015738404.1 340 QDAAFIFDRFLELLQ 354 ***********9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.74 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory