Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_015738684.1 ADEG_RS03370 3-dehydroquinate synthase
Query= BRENDA::Q3M4V2 (363 letters) >NCBI__GCF_000024605.1:WP_015738684.1 Length = 360 Score = 332 bits (851), Expect = 9e-96 Identities = 173/357 (48%), Positives = 243/357 (68%), Gaps = 3/357 (0%) Query: 5 INVNLPTQSYEIAIAPASLDQIGQSLAGLKLGKKVLLVSNPTIFKHFGKVAVDSLEAAGF 64 + V L +SY I + L ++G+ G++++++SN T+ +G+V +SLEAAG+ Sbjct: 4 VRVELGDRSYPIYVGEGLLARVGELTRQHLPGRRLMVISNSTVTGLYGEVLKESLEAAGW 63 Query: 65 QVASYCLPAGERYKTLNSIQKLYDIALENRLERSSTMVALGGGVIGDMTGFAAATWLRGI 124 +V +P GE +K L ++ +LYD+A+E LER ++A GGGV+GD+ GF AAT++RG+ Sbjct: 64 KVLWAEMPDGEEHKNLATVSRLYDLAVEGELERGDAILAFGGGVVGDVAGFVAATFMRGV 123 Query: 125 NVVQVPTTLLAMVDSAIGGKTGVNHPHGKNLIGAFHQPRFVLIDPQVLKTLPVREFRAGM 184 QVPTTLLA VD+++GGK GVNHP GKNLIGAFHQPR V+ D L++LP RE +GM Sbjct: 124 AWGQVPTTLLAQVDASVGGKVGVNHPQGKNLIGAFHQPRLVVADVDTLRSLPRREIASGM 183 Query: 185 AEVIKYGVIWDAELFNQLEQSKRLDQLRYIKPELMDAILTRSCQAKADVVGKDEKEGGLR 244 AEV+KYGVI A F LE++ ++ L + PE + + SC+ KA+VV DEKE GLR Sbjct: 184 AEVVKYGVIRSASFFAWLEEN--VEALLSLAPEALTHAVATSCRIKAEVVAADEKESGLR 241 Query: 245 AILNYGHTVGHAVESLTNYRLLKHGEAVGIGMVAAGQIAVNLGLWQQADADRQNA-LIEK 303 AILN+GHTVGHA+E++T+Y HGEAV IGMV A ++A LGL A+ +R+ A L+E Sbjct: 242 AILNFGHTVGHALEAMTDYVRFAHGEAVAIGMVVASRLARRLGLGFTAEEERRLANLLEA 301 Query: 304 AGLPTKLPAGLDIEGIIEALQLDKKVKDGKVRFVLPTQIGVVTVTDEVTSDHIRQVL 360 GLPT LP G D ++ +Q DKKVK+GK+ F+LP IG V + EV + + +VL Sbjct: 302 IGLPTSLPPGTDPRELLLFMQRDKKVKEGKLTFILPRHIGEVEIVREVPQEILLEVL 358 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 360 Length adjustment: 29 Effective length of query: 334 Effective length of database: 331 Effective search space: 110554 Effective search space used: 110554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_015738684.1 ADEG_RS03370 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.1885.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-123 397.4 0.0 3.6e-123 397.1 0.0 1.0 1 lcl|NCBI__GCF_000024605.1:WP_015738684.1 ADEG_RS03370 3-dehydroquinate sy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015738684.1 ADEG_RS03370 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.1 0.0 3.6e-123 3.6e-123 1 341 [. 13 356 .. 13 358 .. 0.97 Alignments for each domain: == domain 1 score: 397.1 bits; conditional E-value: 3.6e-123 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKslet 67 y+++vgegll+++ e +++ ++l+vi++++v+ l++e l+e l+++g++vl++ +pdgee+K+l+t lcl|NCBI__GCF_000024605.1:WP_015738684.1 13 YPIYVGEGLLARVGELTRQhlPGRRLMVISNSTVTGLYGEVLKESLEAAGWKVLWAEMPDGEEHKNLAT 81 689*********999999864449********************************************* PP TIGR01357 68 vaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlpl 136 v++l+d +e +ler ++++a+GGGvvgD+aGFvAat++RG++ qvPTtlla+vD+svGGK+g+n+p+ lcl|NCBI__GCF_000024605.1:WP_015738684.1 82 VSRLYDLAVEGELERGDAILAFGGGVVGDVAGFVAATFMRGVAWGQVPTTLLAQVDASVGGKVGVNHPQ 150 ********************************************************************* PP TIGR01357 137 gkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealee 205 gkNliGaf+qP++V+ d+++l++lp+re+++GmaEv+K+g+i a++f++le+n ++ll+la eal++ lcl|NCBI__GCF_000024605.1:WP_015738684.1 151 GKNLIGAFHQPRLVVADVDTLRSLPRREIASGMAEVVKYGVIRSASFFAWLEENVEALLSLAP-EALTH 218 ********************************************************9998766.***** PP TIGR01357 206 likrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgl.l 272 +++ s+++KaevV++DekesglRa+LNfGHt+gHa+Ea+++y + HGeaVaiGmvv+ +l+++lgl + lcl|NCBI__GCF_000024605.1:WP_015738684.1 219 AVATSCRIKAEVVAADEKESGLRAILNFGHTVGHALEAMTDYVrFAHGEAVAIGMVVASRLARRLGLgF 287 ******************************************99*********************9735 PP TIGR01357 273 kaellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 ae+ +rl++ll+++glpt+l++ ++ ell ++++DKK +++k++++l+++iG++++ +ev++e lle lcl|NCBI__GCF_000024605.1:WP_015738684.1 288 TAEEERRLANLLEAIGLPTSLPPGTDPRELLLFMQRDKKVKEGKLTFILPRHIGEVEIVREVPQEILLE 356 69999******************************************************9999887765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.20 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory