Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_015738899.1 ADEG_RS04495 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000024605.1:WP_015738899.1 Length = 408 Score = 330 bits (846), Expect = 9e-95 Identities = 183/405 (45%), Positives = 269/405 (66%), Gaps = 11/405 (2%) Query: 340 VVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENPD 399 +VV KFGG+++++ E++++VAE++ + +++G + VVV+SAMGDTTD LI+LA+ + +P Sbjct: 2 LVVQKFGGSSVANAERIKRVAERVWRTRQAGNEVVVVVSAMGDTTDELIDLARQVTSDPS 61 Query: 400 PRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDIIS 459 PRE+D LLSTGE S+AL+++AL+ G +AIS TG Q I TD YG A I ++T + Sbjct: 62 PREMDQLLSTGEQVSIALLAMALQALGAEAISLTGAQAGITTDGIYGKASISAVDTRRLK 121 Query: 460 RYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTAD 519 L IPVVAGFQG+ GD+TTLGRGGSD TA+ALA +L ADLCE+Y DV+GV+TAD Sbjct: 122 EELAAGRIPVVAGFQGLAPNGDVTTLGRGGSDTTAVALAAALQADLCEIYTDVEGVFTAD 181 Query: 520 PRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLIWE 579 PR+V +A + +S++EM+EL+ GA VL RA E A+ Y V + ++++ E GT+I E Sbjct: 182 PRLVPEAVKLPAISYDEMLELACLGAVVLHPRAVELAKIYQVPLRVRSSFSEDPGTVIKE 241 Query: 580 GTKVENP-IVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMKSGEY 638 +E +V V + +A++ + DV D+PG+A R+ +L+ +N+DMIIQGM Sbjct: 242 EDDMEKKRVVSGVAHDLNVARIGIFDVFDRPGIAYRLFSSLAAENINVDMIIQGMTRDGR 301 Query: 639 NTVAFIVPESQLGKLDIDLLKTRSEAKEIIIEKG------LAKVSIVGVNLTSTPEISAT 692 N ++F V +L + LK + KE I KG + KVSIVG + + P ++A Sbjct: 302 NDISFTVSRHELPQ----ALKVVEKVKEEIGAKGYTYDDRVGKVSIVGAGMITRPGVAAA 357 Query: 693 LFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELD 737 +FE L+ EGINI+MIS S ++S II + V AVKA+H F L+ Sbjct: 358 MFEALSREGINIEMISTSEIKVSCIIKEEEVPRAVKALHRHFGLE 402 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 697 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 408 Length adjustment: 36 Effective length of query: 703 Effective length of database: 372 Effective search space: 261516 Effective search space used: 261516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory