Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate WP_015739155.1 ADEG_RS05860 type 1 glutamine amidotransferase
Query= SwissProt::P28819 (194 letters) >NCBI__GCF_000024605.1:WP_015739155.1 Length = 193 Score = 259 bits (661), Expect = 3e-74 Identities = 119/184 (64%), Positives = 149/184 (80%) Query: 2 ILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPDFLMISPGPCSPDEAGI 61 +L+IDNYDSFTYNLVQY ELG E+ V RND++T++EIE P L+ISPGPC+P+EAG+ Sbjct: 6 VLVIDNYDSFTYNLVQYFAELGAEVEVHRNDALTLEEIESRRPTHLVISPGPCTPNEAGV 65 Query: 62 SLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKTIFEGLKNP 121 SL A++HF G++PI GVCLGHQ+I Q FGG +VRA RLMHGKTS I HDG+TIF+GL +P Sbjct: 66 SLAAVRHFTGRLPILGVCLGHQAIGQAFGGRIVRASRLMHGKTSPILHDGRTIFQGLPSP 125 Query: 122 LVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIEGVQFHPESIMTSFGKEML 181 ATRYHSLIV P+++P V+A T+EGEIM +RH P+EGVQFHPESI+T GKE+L Sbjct: 126 FTATRYHSLIVAPDSVPPELEVSAWTEEGEIMGLRHRLYPVEGVQFHPESILTECGKELL 185 Query: 182 RNFI 185 NF+ Sbjct: 186 ANFL 189 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 193 Length adjustment: 20 Effective length of query: 174 Effective length of database: 173 Effective search space: 30102 Effective search space used: 30102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
Align candidate WP_015739155.1 ADEG_RS05860 (type 1 glutamine amidotransferase)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.2109.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-87 278.2 0.0 2e-87 278.0 0.0 1.0 1 lcl|NCBI__GCF_000024605.1:WP_015739155.1 ADEG_RS05860 type 1 glutamine am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015739155.1 ADEG_RS05860 type 1 glutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 278.0 0.0 2e-87 2e-87 1 191 [. 5 190 .. 5 191 .. 0.99 Alignments for each domain: == domain 1 score: 278.0 bits; conditional E-value: 2e-87 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaisslelie 69 +vl+idnydsftynlvq+++elgaev v+rnd+ltl+eie p + +visPGPctP+ea++s l++++ lcl|NCBI__GCF_000024605.1:WP_015739155.1 5 HVLVIDNYDSFTYNLVQYFAELGAEVEVHRNDALTLEEIESRRPTH-LVISPGPCTPNEAGVS-LAAVR 71 79********************************************.****************.9**** PP TIGR00566 70 hlaGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvvea 138 h++G+lPilGvClGhqa++qafG+ +vra++++hGk+s i h+g+++f+gl +P ++atryhsl+v + lcl|NCBI__GCF_000024605.1:WP_015739155.1 72 HFTGRLPILGVCLGHQAIGQAFGGRIVRASRLMHGKTSPILHDGRTIFQGLPSP--FTATRYHSLIVAP 138 ******************************************************..************* PP TIGR00566 139 etldtllevtaleeeeieimairhrdlpleGvqfhPesilselGkellanflk 191 ++++ lev+a++ee eim++rhr +p+eGvqfhPesil+e Gkellanfl lcl|NCBI__GCF_000024605.1:WP_015739155.1 139 DSVPPELEVSAWTEEG-EIMGLRHRLYPVEGVQFHPESILTECGKELLANFLA 190 ***************9.**********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (193 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.30 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory