Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_015798939.1 AFER_RS07955 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000023265.1:WP_015798939.1 Length = 308 Score = 191 bits (485), Expect = 2e-53 Identities = 110/300 (36%), Positives = 174/300 (58%), Gaps = 12/300 (4%) Query: 7 IAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKS 66 + + + + VP+ +AK+ V THALHYG F G+R P +FRL H RL +S Sbjct: 8 VIWMDGEVVPWGEAKVHVLTHALHYGYGVFEGIRAYDTPRGSA---VFRLREHLVRLHRS 64 Query: 67 AKFLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVYSS--GLGIAPRLHNLEKDFLV 122 A+ L +I S +++ E V N + + YIRP+ +++ +G++P ++ Sbjct: 65 ARMLLMEIPFSVDELIEATRTVVAANG-EPACYIRPVAFTAYGEMGLSPLSSSISVSIAT 123 Query: 123 Y--GLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 + G +GD A GV ++SSW R + P K++ Y+ SALAK EA+++G+DEAI Sbjct: 124 WPWGAYLGDEGIAKGVRAKVSSWRRHDPNVIPPAAKVTGGYVNSALAKAEAIKAGYDEAI 183 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 L++ QG V E TG N+F V +G IVTP L GITR +I+T+AAD GIP + + + Sbjct: 184 LLSPQGYVSECTGENLFAVFDGAIVTPPIAAGALAGITRQTIMTLAADAGIPVREANLLR 243 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLRSVLTAVTENREPKYQDWV 298 S+L IADEVFLSGTAA++ P+ +++ +G P+ +L+ A +P+++ W+ Sbjct: 244 SDLYIADEVFLSGTAAEVVPIASVDDRPVGTGEPGPLARELQRRYYAAVHGEDPQHESWL 303 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 308 Length adjustment: 27 Effective length of query: 278 Effective length of database: 281 Effective search space: 78118 Effective search space used: 78118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory