Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_015799095.1 AFER_RS08805 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000023265.1:WP_015799095.1 Length = 381 Score = 245 bits (626), Expect = 1e-69 Identities = 154/381 (40%), Positives = 207/381 (54%), Gaps = 29/381 (7%) Query: 5 ALLVLEDGTQFHGRAIGATG------SAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYP 58 A LVL G +F G + G EVVFNT+M+GY E +TDPSY Q+V T Sbjct: 13 AWLVLRSGARFRGAVVIPAGVEPLLDDVEAEVVFNTAMSGYVEAITDPSYYGQMVCFTTA 72 Query: 59 HIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKL 118 H+G G AD +S + ++ ++ASN L+++L + D D+R+L Sbjct: 73 HLGTYGVRRADVQSVRPWVSAVLAPRYSVVASNHAADTTLAAWLWEARVPLFVDFDSRRL 132 Query: 119 TRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLT 178 RL+R GA+ G I GD PDAA E+ R G G DL + VT E Sbjct: 133 VRLVRAAGAEPGIITTGD-PDAAA--ERVRVAVGTEGRDLVRAVTRREPRELE------- 182 Query: 179 GGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRG-CRLTIVPAQTSAEDVLKMNPDGIF 237 P P +VA DFG K +L L RG RL +VPA E++ K++P +F Sbjct: 183 ---PLGHARSSRP--IVAIDFGVKERMLETL--RGPWRLVVVPATIRLEELEKLDPLAVF 235 Query: 238 LSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPV 297 LSNGPGDPA I ++ L +P+ GICLGHQLLALA+GA+T+K+ FGHHG NHPV Sbjct: 236 LSNGPGDPAALTGPIELVRSLLGV-VPIAGICLGHQLLALAAGAETIKLPFGHHGSNHPV 294 Query: 298 KDVEKNVVMITAQNHGFAVDEAT---LPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHP 354 + E V ITAQNH +AVDEA+ L VT ++LFDG ++G+ A S Q HP Sbjct: 295 RLEETGRVAITAQNHSYAVDEASLGRLDTPAEVTRRNLFDGVVEGLRLPALGAVSVQYHP 354 Query: 355 EASPGP-HDAAPLFDHFIELI 374 EA+PGP ++ + D + L+ Sbjct: 355 EAAPGPLEQSSEIHDELLSLL 375 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 381 Length adjustment: 30 Effective length of query: 352 Effective length of database: 351 Effective search space: 123552 Effective search space used: 123552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_015799095.1 AFER_RS08805 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.8537.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-104 333.7 0.0 7.3e-104 333.5 0.0 1.0 1 lcl|NCBI__GCF_000023265.1:WP_015799095.1 AFER_RS08805 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023265.1:WP_015799095.1 AFER_RS08805 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 333.5 0.0 7.3e-104 7.3e-104 20 356 .. 38 372 .. 13 376 .. 0.91 Alignments for each domain: == domain 1 score: 333.5 bits; conditional E-value: 7.3e-104 TIGR01368 20 kevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkglvvkelskevsny 88 +v +evvFnT+m+GY E++tDpsY gq+v +t+ ++g ygv++ d++s +++v++++ +s +sn+ lcl|NCBI__GCF_000023265.1:WP_015799095.1 38 DDVEAEVVFNTAMSGYVEAITDPSYYGQMVCFTTAHLGTYGVRRADVQSVRPWVSAVLAPRYSVVASNH 106 46789**************************************************************** PP TIGR01368 89 rakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakespkvkevnlvkev 157 a ++L+++l e ++ + D R lv+ +R +g+ ++i+t + + ++e+++++ +++ +lv+ v lcl|NCBI__GCF_000023265.1:WP_015799095.1 107 AADTTLAAWLWEARVPLFVDFDSRRLVRLVRAAGAEPGIITTGD--PDAAAERVRVAVGTEGRDLVRAV 173 *******************************************9..6678888999999999******* PP TIGR01368 158 stkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgillsnGP 226 + +e+ ele + +++ +v+id+GvKe +l++L +++vvpa+ ++ee++kl+p +++lsnGP lcl|NCBI__GCF_000023265.1:WP_015799095.1 174 TRREPRELEPL-GHARSSRPIVAIDFGVKERMLETLR-GPWRLVVVPATIRLEELEKLDPLAVFLSNGP 240 ********973.33334458*************9996.579**************************** PP TIGR01368 227 GdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqN 295 GdPaa++ ie v++ll+ +Pi GIclGhqllala+ga+t+kl fGh+G+Nhpv+ +tgrv it+qN lcl|NCBI__GCF_000023265.1:WP_015799095.1 241 GDPAALTGPIELVRSLLG-VVPIAGICLGHQLLALAAGAETIKLPFGHHGSNHPVRLEETGRVAITAQN 308 ******************.************************************************** PP TIGR01368 296 Hgyavdeesl..keeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphd.teylFdefv 356 H+yavde+sl + +evt +nl+Dg vegl+ l ++svQyHPea+pGp + ++ + de++ lcl|NCBI__GCF_000023265.1:WP_015799095.1 309 HSYAVDEASLgrLDTPAEVTRRNLFDGVVEGLRLPALGAVSVQYHPEAAPGPLEqSSEIHDELL 372 *********83345779***********************************762566777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (381 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.92 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory