Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; EC 1.1.1.85; Beta-IPM dehydrogenase (uncharacterized)
to candidate WP_015799363.1 AFER_RS10270 NADP-dependent isocitrate dehydrogenase
Query= curated2:O29627 (326 letters) >NCBI__GCF_000023265.1:WP_015799363.1 Length = 483 Score = 221 bits (564), Expect = 2e-62 Identities = 131/313 (41%), Positives = 183/313 (58%), Gaps = 9/313 (2%) Query: 4 IVVIPGDGIGKEVMEAAMLILEKLDLPFEYSYYDAGDEALEKYG--KALPDETLEACRKS 61 I V GDGIG E+M A + +LEK + G EAL + G + E+ R++ Sbjct: 11 ITVAYGDGIGPEIMSAVLEVLEKAGARLAIETIEVG-EALWRRGITSGIEPSAWESLRRT 69 Query: 62 DAVLFGAA----GETAADVIVRLRRELGTFANVRPAKAIEG-IECLYPGLDIVVVRENTE 116 L G + V +R+ LG FANVRP I+ +PG+D+VV+REN E Sbjct: 70 KVFLKAPITTPRGGGMKSLNVTIRKALGLFANVRPCPTYAPFIQTAHPGMDVVVIRENEE 129 Query: 117 CLYMGFEFG-FGDVTEAIRVITREASERIARYAFELAKREGRKKVTALHKANVMKKTCGL 175 LY G E DV + +++I+R +ER+ RYAF A+R GR KVT L K N+MK T GL Sbjct: 130 DLYGGIEHRQTEDVVQCLKLISRPGTERLVRYAFAYAERHGRHKVTCLVKDNIMKLTDGL 189 Query: 176 FRDVCREVAKDYPEIQYNDYYIDAACMYLVMDPFRFDVIVTTNMFGDIVSDLAAGLVGGL 235 FR V EVA++YP ++ +D L P FDV+VT N++GDIVSD+ A + G + Sbjct: 190 FRQVFEEVAREYPNLETETLIVDIGTARLAARPEDFDVVVTPNLYGDIVSDVVAEVAGSV 249 Query: 236 GLAPSANVGERTAIFEPVHGAAFDIAGKGIANPTAMILTACMMLRHFGYVEEAKKVEEAV 295 GL SANVG A+FE +HG+A +IAG+GIANP+ ++L A +ML H G + A++V A Sbjct: 250 GLGASANVGAEVAMFEAIHGSAPEIAGRGIANPSGLLLAAVLMLVHVGQGDVAERVHNAW 309 Query: 296 EKTIKEGKKTPDL 308 TI++G T D+ Sbjct: 310 LATIEDGIHTADV 322 Lambda K H 0.321 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 483 Length adjustment: 31 Effective length of query: 295 Effective length of database: 452 Effective search space: 133340 Effective search space used: 133340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory