Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate WP_015818168.1 TERTU_RS11085 3-isopropylmalate dehydrogenase
Query= BRENDA::P93832 (405 letters) >NCBI__GCF_000023025.1:WP_015818168.1 Length = 357 Score = 429 bits (1102), Expect = e-125 Identities = 215/353 (60%), Positives = 271/353 (76%) Query: 45 ITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETISAAK 104 I LLPGDGIGPE+V+ A VL+ + F E IGG+A+D+ GVPL T+ + Sbjct: 5 IVLLPGDGIGPEIVAEAVKVLEVVDKKHKLGLKFEEELIGGSAIDVHGVPLASSTLEKCQ 64 Query: 105 ESDAVLLGAIGGYKWDNNEKHLRPEKGLLQIRAALKVFANLRPATVLPQLVDASTLKREV 164 +DAVL+G++GG KWD + +RPEKGLL+IR + +F NLRPA + PQL DAS+LK E+ Sbjct: 65 AADAVLMGSVGGPKWDTLDSSIRPEKGLLKIRYEMGLFGNLRPAILYPQLADASSLKPEL 124 Query: 165 AEGVDLMVVRELTGGIYFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRR 224 G+D+++VRELTGGIYFGEPRGI+ +NGE G+NT VYA HEI+RI R+AFE A KR Sbjct: 125 VAGLDILIVRELTGGIYFGEPRGIRLLDNGERQGYNTYVYAEHEIERIGRMAFEMAMKRN 184 Query: 225 GKLCSVDKANVLEASILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNN 284 K+CSVDKANVLEA++LWR+ V +L+ EYP+VELSHMYVDNAAMQLVR PKQFD IVT N Sbjct: 185 KKVCSVDKANVLEATVLWREVVQSLSREYPEVELSHMYVDNAAMQLVRQPKQFDVIVTGN 244 Query: 285 IFGDILSDEASMITGSIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAM 344 +FGDILSD A+M+TGSIGMLPSASL+ GL+EP+HGSAPDIAGQ ANPLATILSAAM Sbjct: 245 MFGDILSDTAAMLTGSIGMLPSASLNKDKRGLYEPVHGSAPDIAGQGIANPLATILSAAM 304 Query: 345 LLKYGLGEEKAAKRIEDAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSV 397 +L+Y L + +AA IE AV L++G+R+ DI+S G V KEMG+ V+ ++ Sbjct: 305 MLRYSLDQGEAADAIEAAVGKVLDDGYRSADIFSEGCTKVSTKEMGDAVVAAI 357 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 357 Length adjustment: 30 Effective length of query: 375 Effective length of database: 327 Effective search space: 122625 Effective search space used: 122625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_015818168.1 TERTU_RS11085 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.1255.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-166 539.3 0.0 2.2e-166 539.1 0.0 1.0 1 lcl|NCBI__GCF_000023025.1:WP_015818168.1 TERTU_RS11085 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023025.1:WP_015818168.1 TERTU_RS11085 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 539.1 0.0 2.2e-166 2.2e-166 1 348 [. 4 352 .. 4 353 .. 0.99 Alignments for each domain: == domain 1 score: 539.1 bits; conditional E-value: 2.2e-166 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlg 69 ki++LpGDgiGpe+vaea+kvL++v+++++l l+fee liGG aid +g Pl+ tl++c++adavL+g lcl|NCBI__GCF_000023025.1:WP_015818168.1 4 KIVLLPGDGIGPEIVAEAVKVLEVVDKKHKLGLKFEEELIGGSAIDVHGVPLASSTLEKCQAADAVLMG 72 79******************************************************************* PP TIGR00169 70 avGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiY 138 +vGGpkWd+l +++rPekgLLk+r e++lf nLrPa l+++L ++s+lk+e+v g+D+++vreLtgGiY lcl|NCBI__GCF_000023025.1:WP_015818168.1 73 SVGGPKWDTLDSSIRPEKGLLKIRYEMGLFGNLRPAILYPQLADASSLKPELVAGLDILIVRELTGGIY 141 ********************************************************************* PP TIGR00169 139 fGepkereeaee.ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeia 206 fGep++++ ++ e+++++t +Y ++eieri r+afe+a+kr+kkv+svDkanvLe++ lWr++v+ + lcl|NCBI__GCF_000023025.1:WP_015818168.1 142 FGEPRGIRLLDNgERQGYNTYVYAEHEIERIGRMAFEMAMKRNKKVCSVDKANVLEATVLWREVVQSLS 210 *******998888******************************************************** PP TIGR00169 207 keyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfep 275 +eyP+vel+h+y+DnaamqLv++P+q+dv+vt+n+fGDilsD a+++tGs+G+LPsasl++++ +l+ep lcl|NCBI__GCF_000023025.1:WP_015818168.1 211 REYPEVELSHMYVDNAAMQLVRQPKQFDVIVTGNMFGDILSDTAAMLTGSIGMLPSASLNKDKRGLYEP 279 ********************************************************************* PP TIGR00169 276 vhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseattavstke 344 vhgsapdiag+gianp+a+ilsaa++lrysl++ eaa+aieaav kvl++g+r++d+ se++t+vstke lcl|NCBI__GCF_000023025.1:WP_015818168.1 280 VHGSAPDIAGQGIANPLATILSAAMMLRYSLDQGEAADAIEAAVGKVLDDGYRSADIFSEGCTKVSTKE 348 ********************************************************************* PP TIGR00169 345 veee 348 +++ lcl|NCBI__GCF_000023025.1:WP_015818168.1 349 MGDA 352 *986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.66 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory